Details for Chinese cabbage Locus Brara.H02144

Position : A08 ( 5`- 19033837 .. 19034784 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H02144

Protein [Map View]
MEKMIEREYMCKFCNKKLPSGKSLGGHIRIHTNQYSLLSSSYNGKNNNNKRLAGQREITALTQQQQQLCCSKCGKAFDSL
KALWNHMDCCHCEGEKLVMDTETTSSGPTRKRSKKQFSSESFSNGSSSSSACEIDQDDKNTALSLMMMSMDSRGFTLVVN
SLVAESSENNSDDDDDNGAILSDSYSSDSDYFMNGPKKPDSDILVDECLRNNNGDEFVVKEGRSKYELRKSKRVVLPCYE
SDSCAVDTNSKKAISANKNGKCHECPFCFRVFKSGQALGGHKRSHSFVNQEHRVKHKAAGDMQIDLNLPAHDVEE*

DNA
ATGGAGAAGATGATAGAGAGGGAGTACATGTGCAAGTTCTGTAACAAGAAGTTACCTTCTGGTAAATCACTTGGAGGTCA
CATCAGGATTCACACCAACCAGTACTCACTTCTTTCAAGTAGCTACAATGGCAAGAACAACAACAATAAGAGGTTGGCGG
GTCAGAGAGAGATCACGGCTCTAACACAGCAGCAGCAACAACTTTGTTGCAGCAAATGTGGTAAAGCTTTTGATTCTTTG
AAAGCTCTTTGGAATCACATGGATTGTTGTCACTGTGAGGGAGAGAAGTTGGTGATGGATACTGAGACTACTTCTTCAGG
TCCTACCAGGAAAAGATCCAAGAAGCAGTTCAGTTCAGAGTCTTTTAGTAATGGGAGCTCGTCTTCTTCTGCTTGTGAGA
TTGACCAAGATGATAAGAACACTGCTTTGTCTCTCATGATGATGTCTATGGACTCTAGAGGATTTACCTTGGTGGTTAAC
TCTCTAGTAGCTGAGTCTTCAGAGAATAACTCTGATGATGATGATGATAATGGTGCTATTCTCTCTGATTCATATAGCTC
AGACTCTGATTACTTCATGAATGGTCCAAAGAAGCCAGACTCAGATATCTTGGTTGACGAGTGTCTTAGGAACAATAATG
GTGATGAGTTTGTGGTCAAGGAGGGAAGATCAAAGTATGAGCTGCGCAAAAGCAAAAGGGTTGTCTTGCCTTGTTATGAG
AGTGATTCTTGTGCAGTAGACACAAACAGCAAGAAAGCAATTAGTGCAAACAAGAATGGCAAATGTCACGAGTGCCCATT
CTGCTTCAGAGTGTTCAAGTCAGGACAAGCTTTAGGAGGTCACAAGAGATCACATTCTTTTGTGAACCAAGAACACAGGG
TCAAACACAAAGCTGCTGGTGATATGCAAATCGATCTCAATCTTCCTGCTCATGATGTTGAAGAATGA