Details for Chinese cabbage Locus Brara.H02143

Position : A08 ( 5`- 19030370 .. 19032891 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H02143

Protein [Map View]
MGFKRPLDDNKFHELPFKHSRPLGFNDKSMQFEESLQSPLATVVDEGDLLKPQGGETFDEESCFAYPGLDMDGCFDRVME
DCHGEDATHSPHSPRTFAPVESFYSFLLDQPARKQVLTRPDHQAMIPEWEGSLNRNLEPLGTGTCVLPMPAHMDDNIVGK
GREFCVCQDMGSIRCVRQHVKEAREDMVKVLGSEKFRDMGLCDMGEEVAQRWSDEDALLFHEVVYSYPATLGQNFWKHLE
AVFLSRTKHEIVSYYFNVFVLRRRAAQNRSMILDIDSDDDEWHGGSGGGPLGAQYVEEDFAVESPLHQETEKFNEKVHPL
HQEEDASISDNDEDDTKEGGSGLCDEHKMNAGYMDMFSGCNEERLNVEDDSCLTFELAHDAVNSVCKKCAKKEETGLGDE
QKKVEGV*

DNA
ATGGGATTCAAACGCCCTTTAGATGATAACAAGTTTCATGAGCTCCCGTTTAAACATTCTAGACCGCTTGGCTTTAACGA
CAAGTCTATGCAGTTTGAAGAGTCTTTGCAGAGTCCTCTTGCCACAGTAGTGGATGAGGGAGATCTTTTGAAACCCCAAG
GAGGTGAAACCTTTGATGAAGAGTCTTGTTTCGCTTACCCGGGTCTAGACATGGATGGTTGTTTTGATCGGGTCATGGAA
GATTGCCATGGAGAAGATGCAACTCACTCTCCTCACTCTCCTAGAACGTTTGCTCCTGTTGAGTCTTTCTATTCTTTCCT
CTTGGATCAACCTGCTAGAAAGCAAGTGCTCACTAGACCAGATCATCAAGCCATGATTCCTGAATGGGAAGGTAGTCTAA
ATAGGAACCTAGAACCTCTAGGCACTGGTACATGTGTTCTTCCCATGCCGGCACATATGGATGACAACATAGTAGGGAAA
GGTAGAGAGTTCTGTGTCTGCCAGGACATGGGTTCTATAAGGTGTGTGCGCCAGCATGTTAAAGAAGCTAGAGAAGACAT
GGTTAAGGTGCTTGGATCTGAGAAATTCAGAGACATGGGCTTGTGTGATATGGGAGAAGAAGTTGCACAGAGGTGGAGCG
ATGAAGATGCACTACTTTTTCATGAGGTTGTTTATTCCTATCCAGCGACGTTAGGTCAGAACTTTTGGAAGCACTTGGAA
GCTGTGTTTTTATCTCGAACCAAGCACGAGATTGTTAGCTACTACTTTAACGTTTTTGTTCTTAGAAGAAGGGCCGCTCA
GAATAGGTCTATGATATTGGACATTGATAGTGATGATGATGAATGGCATGGAGGTTCTGGAGGAGGACCTTTGGGTGCTC
AATATGTCGAAGAAGACTTTGCTGTCGAATCTCCTCTTCATCAAGAGACTGAAAAGTTCAATGAGAAAGTGCATCCACTT
CATCAGGAAGAAGATGCCAGTATTAGTGACAATGATGAAGATGATACCAAAGAAGGTGGTAGTGGACTGTGTGATGAGCA
CAAGATGAATGCTGGGTATATGGATATGTTTTCTGGGTGCAATGAGGAGAGATTGAACGTGGAAGATGACTCATGCTTGA
CCTTTGAGCTTGCACATGATGCGGTGAACTCTGTCTGTAAGAAATGTGCAAAGAAAGAAGAGACTGGTCTTGGTGATGAA
CAGAAGAAAGTCGAAGGAGTGTAA