Details for Chinese cabbage Locus Brara.H00087

Position : A08 ( 5`- 689203 .. 690995 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00087

Protein [Map View]
MDQFSGGGNWSMIPNVQAQGNFGTPTNQDHLFLQQQQQPQQFHHPQQQQTQQQFQPQQQQQEMQFQQFQQQQQFIQQQQF
HHQQHRLLHSPQQPQSSLQSPPPQQTVVHTPQSMMHTPQQQQQLVHTPQQSVQTPQQHQSLASHFHLYPLVEKLSDAVET
GTRDQNSDALVSELNGHFDKCQQLLNSISGSLGSKTTMTVDGQKRNLEESEQLLQQRRDLIMEYRKSIEDLVKIEP*

DNA
ATGGATCAGTTCTCAGGAGGAGGCAATTGGTCGATGATCCCCAACGTTCAGGCGCAGGGTAACTTCGGTACACCCACCAA
TCAAGACCATCTATTCCTCCAGCAACAACAACAACCACAACAGTTTCATCATCCACAACAACAACAAACCCAACAGCAGT
TCCAGCCACAACAACAGCAACAAGAGATGCAGTTCCAGCAATTCCAACAACAACAACAGTTCATTCAACAGCAGCAGTTC
CATCACCAGCAGCACCGTCTGCTACATTCTCCTCAGCAGCCGCAGTCGTCTTTGCAGTCCCCTCCGCCGCAGCAGACGGT
GGTTCATACTCCGCAGTCGATGATGCATACACCGCAGCAACAGCAGCAGTTGGTGCATACTCCGCAGCAATCGGTTCAGA
CTCCGCAGCAGCACCAGTCTTTAGCTTCCCATTTCCATCTCTATCCTTTGGTGGAGAAACTATCAGATGCAGTTGAAACT
GGAACACGAGATCAGAACTCTGATGCCCTGGTGAGTGAATTGAACGGTCATTTTGACAAGTGTCAACAGCTGTTAAATTC
GATTTCAGGATCTCTAGGATCTAAAACTACTATGACTGTTGATGGACAAAAGAGGAATTTAGAAGAAAGTGAGCAACTGC
TTCAACAAAGAAGGGACTTGATTATGGAATATAGGAAATCTATTGAAGATCTTGTCAAGATAGAGCCATAG