Details for Chinese cabbage Locus Brara.H00086

Position : A08 ( 5`- 684338 .. 689545 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00086

Protein [Map View]
MRMLKVATCNLNQWAMDFECNMKNIKASIVQAKAAGAAIRLGPELEVTGYGCEDHFLELDTVTHAWDCLKELLLGDWTND
ILCSIGMPVIKGAERYNCQVLCMNKRIIMIRPKMCLANDGNYRELRWFTAWKQRGELEEFHLPIEISEALSQESVPFGYG
YIQFIDTAVAAEVCEELFSPVPPHAELALNGVEVFMNASGSHHQLRKLDIRLNAFMGATHARGGVYMYSNQQGCDGGRLY
YDGCACIVVNGDVVAQGSQFSLKDVEVITSQVDLDAVASLRGSISSFQEQASCKVKVSSVYVPCRLTQSFNLKMTLSSPK
KIMYHFPQEEIAFGPACWLWDYLRRSGASGFLLPLSGGADSSSVAAIVGCMCQLVVKEIANGDEQVKTDAKRIGNYTNGE
FPTESKEFAKRIFYTVFMGSENSSEATKMRAKQLADEIGAWHLDVCIDGVVSAVLTLFQTVTGMRPRYKVDGGSNVENLG
LQNIQARMRMVLAFMLASLLPWVHSKPGFYLVLGSSNVDEGLRGYLTKYDCSSADINPIGSISKQDLRLFLRWAATNLGY
QSLAEIEAAPPTAELEPIRSDYSQLDEVDMGMTYEELSVYGRMRKIFRCGPVSMFKNLCYKWGTKLSPAEVAEKVKYFFK
YYSINRHKMTVLTPSYHAESYSPEDNRFDLRQFLYNSKWPYQFKKIDEIVDGLNGDSVAFPGEEASYGKEVGVVAANSGD
PSAGL*

DNA
ATGAGGATGTTGAAAGTAGCGACGTGTAACTTGAACCAATGGGCTATGGACTTCGAATGCAACATGAAGAACATCAAGGC
TTCCATTGTCCAGGCTAAGGCTGCCGGTGCCGCCATCAGGCTTGGTCCCGAGCTCGAGGTCACTGGTTATGGCTGTGAGG
ATCACTTCTTGGAGCTAGACACCGTCACTCACGCGTGGGATTGTTTAAAGGAATTGCTGCTTGGTGACTGGACGAATGAT
ATATTATGTAGCATAGGAATGCCTGTAATCAAAGGAGCAGAACGGTATAACTGTCAGGTTCTCTGTATGAACAAAAGAAT
CATCATGATTCGACCAAAGATGTGCCTCGCCAACGATGGAAACTATAGAGAGCTGAGGTGGTTCACGGCTTGGAAGCAGA
GAGGAGAGCTCGAGGAGTTTCACCTCCCTATTGAAATCTCAGAGGCCTTGTCACAGGAATCAGTCCCTTTTGGATATGGT
TACATCCAGTTTATCGACACAGCTGTTGCAGCCGAAGTCTGTGAGGAGCTGTTTAGTCCAGTCCCTCCTCATGCTGAGCT
TGCGCTGAACGGTGTGGAGGTGTTTATGAATGCGAGTGGGAGTCATCACCAGCTAAGAAAGCTTGATATTCGTTTGAATG
CTTTCATGGGGGCTACTCATGCTCGTGGTGGTGTTTATATGTACAGCAATCAACAGGGATGCGATGGTGGCCGCTTATAC
TACGATGGATGTGCATGCATTGTTGTAAACGGAGATGTTGTAGCTCAAGGCTCACAGTTCTCGTTGAAGGACGTTGAGGT
CATCACTTCCCAAGTGGATCTAGATGCGGTTGCTAGTCTTCGCGGATCGATAAGTAGTTTTCAGGAACAAGCAAGTTGTA
AAGTGAAAGTATCTTCAGTATACGTGCCCTGTAGGCTGACTCAGTCCTTCAACCTAAAAATGACACTAAGCAGTCCGAAG
AAGATTATGTACCACTTTCCACAAGAAGAAATAGCCTTTGGTCCTGCTTGCTGGCTATGGGACTATTTGAGAAGAAGCGG
CGCTTCAGGGTTCTTGCTTCCTCTTTCTGGTGGAGCAGACAGCTCGTCTGTGGCGGCTATTGTTGGCTGCATGTGCCAAC
TTGTTGTTAAAGAGATTGCAAATGGAGATGAGCAAGTGAAAACTGATGCCAAACGGATTGGGAATTATACTAATGGAGAG
TTTCCTACTGAGAGCAAAGAGTTTGCTAAGCGAATATTTTACACTGTGTTTATGGGGTCTGAAAACAGTTCTGAGGCGAC
AAAAATGCGTGCAAAGCAGCTTGCAGACGAGATCGGTGCATGGCATCTTGATGTTTGCATAGATGGCGTTGTCTCTGCGG
TTCTAACTTTATTTCAAACGGTTACTGGCATGCGTCCTCGGTATAAGGTTGATGGAGGATCAAACGTTGAGAATCTTGGG
TTGCAGAACATTCAAGCACGGATGAGAATGGTGTTAGCGTTTATGTTAGCGTCTCTCTTGCCTTGGGTTCATAGCAAACC
AGGCTTTTACCTTGTTCTAGGCAGCTCCAATGTTGATGAAGGACTTCGTGGTTACCTGACAAAGTATGATTGTAGCTCAG
CAGACATAAACCCCATAGGAAGTATTAGTAAACAGGATCTGAGGTTGTTCCTAAGATGGGCTGCAACGAATCTCGGTTAT
CAGTCCTTGGCAGAGATAGAAGCTGCTCCACCAACAGCTGAGCTTGAGCCCATTCGTTCTGACTATTCTCAGCTTGATGA
AGTCGACATGGGAATGACATATGAAGAGCTCTCAGTCTATGGAAGGATGAGGAAGATATTCCGGTGTGGCCCAGTTTCCA
TGTTCAAGAATCTATGTTACAAGTGGGGAACAAAGCTAAGCCCAGCAGAAGTAGCTGAGAAAGTGAAGTACTTCTTCAAG
TATTATTCGATCAATCGACACAAGATGACTGTCCTCACACCGTCCTACCACGCTGAGAGTTACTCTCCAGAGGACAACAG
GTTCGATCTGAGGCAGTTTCTGTATAATAGCAAGTGGCCATACCAGTTCAAGAAGATTGACGAGATTGTTGACGGCCTAA
ATGGTGACTCAGTTGCTTTTCCAGGAGAAGAAGCAAGCTACGGCAAAGAAGTTGGAGTCGTGGCTGCAAATTCCGGTGAT
CCAAGCGCGGGTCTCTGA