Details for Chinese cabbage Locus Brara.H00083

Position : A08 ( 5`- 667283 .. 679312 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00083

Protein [Map View]
MMMNKDMLYNHQQQHGEENMSNLTSASGDHASVSSGNRTETSGSNFHYNTNPNQQQEEQCLAPQPSQKKKRNQPGNPDPE
AEVLALSPKTLMATNRFICEICNKGFQRDQNLQLHKRGHNLPWKLKQRSNKDVIRKKVYVCPEPNCVHHHPSRALGDLTG
IKKHFFRKHGEKKWKCDKCSKKYAVQSDWKAHAKTCGTKEYKCDCGTLFSRAFCDALAEESARAIPNPILIQSSSPHQTQ
HNINFSSSSQNITSHNNNPHGHDELPMKQEEPHHHFHNIPPWLISSNPNPNGNNANYFPLASSSASFHHSSPAMSATALL
HKAAQMGRTKSTATPEEEEERVDDYYNTMAASMMTSPSEHGFGFQDYYMMNQHPHHHHGVGEAFDGGFIAVDEKNDVGDD
GGGETRDFLGLKSLMSDNEMLSFANNLGNCINTSASEQQERYSHQD*

DNA
ATGATGATGAACAAAGATATGTTATATAATCATCAACAACAACATGGGGAGGAAAACATGTCCAATCTAACATCAGCTTC
AGGAGATCATGCAAGTGTGTCTTCAGGAAACAGAACTGAGACTAGTGGCTCCAACTTTCATTACAACACTAATCCAAATC
AGCAACAGGAAGAACAGTGTCTTGCTCCACAACCATCTCAAAAGAAGAAGAGAAACCAACCCGGCAATCCAGACCCAGAA
GCAGAAGTGTTGGCTTTATCACCAAAAACACTAATGGCAACAAACAGATTCATATGCGAGATCTGCAACAAAGGGTTTCA
AAGAGACCAGAACTTGCAGCTTCACAAGAGAGGACACAATCTACCATGGAAGCTTAAACAAAGATCAAACAAAGACGTGA
TAAGGAAGAAAGTCTATGTCTGTCCCGAGCCAAACTGTGTCCATCATCATCCATCAAGAGCTCTAGGAGACTTAACAGGA
ATCAAAAAGCATTTCTTTAGAAAACATGGGGAGAAAAAATGGAAATGCGATAAGTGTTCGAAGAAGTATGCGGTGCAATC
AGATTGGAAGGCTCATGCTAAGACTTGTGGCACCAAAGAATACAAATGCGACTGTGGAACTCTCTTTTCAAGAGCATTTT
GTGATGCATTAGCAGAAGAGAGTGCAAGAGCCATACCAAACCCTATTCTCATCCAATCTTCTTCTCCTCATCAAACTCAA
CACAACATAAACTTCTCTTCCTCCTCACAAAACATCACCAGCCACAATAACAATCCCCATGGTCATGATGAACTTCCCAT
GAAGCAAGAAGAGCCACATCATCACTTCCACAACATCCCTCCTTGGCTCATCTCATCAAACCCTAACCCTAATGGCAACA
ATGCTAATTACTTCCCTCTTGCTTCTTCTTCTGCAAGCTTCCACCACTCATCTCCAGCAATGTCAGCCACAGCTTTGCTC
CATAAAGCAGCTCAAATGGGTCGAACAAAGTCAACAGCTACTCCAGAGGAAGAAGAAGAGAGGGTTGATGACTACTACAA
TACAATGGCTGCATCGATGATGACGTCACCATCAGAACATGGATTCGGGTTTCAAGACTACTATATGATGAATCAGCATC
CTCATCATCATCACGGCGTTGGAGAAGCTTTCGACGGTGGTTTTATCGCCGTAGACGAGAAGAACGATGTGGGAGACGAC
GGTGGTGGAGAGACTAGAGATTTCTTGGGGTTAAAATCGTTAATGTCTGATAATGAGATGCTAAGTTTCGCTAATAATCT
TGGTAACTGTATCAACACTTCTGCTTCAGAGCAACAAGAACGATACAGCCATCAAGATTAG