Details for Chinese cabbage Locus Brara.H00082

Position : A08 ( 5`- 660862 .. 663053 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00082

Protein [Map View]
MAMVSAASSGLVRAALDTKPKKLRYNPNAPRNVKRNPNSTTSFVPPSSPSSSPAATVLTTTSVSVSDLLKRPASKEDIGG
DEDSCVGYEKWFPSPPKVGKPRSVFNAASLAYIGDSIYEIYARRHFLFPPLSIEEYNDRVRAVVRCEAQYALLHKLLDED
FLTKDEREILRWGKNVGSVKTRSTRRAGVAVYNKASSLETLIGYLYLANGKRLEEIMQKLGFSSSSSTEIMVKEAKHKLS
ALK*

DNA
ATGGCGATGGTATCAGCAGCAAGCTCTGGTCTGGTGAGAGCTGCTTTAGACACGAAGCCTAAGAAGCTCCGATACAACCC
CAATGCGCCGCGTAACGTCAAGAGAAACCCTAATTCTACTACCTCTTTCGTGCCTCCATCATCTCCTTCGTCTTCTCCGG
CGGCGACAGTCTTGACAACAACTAGCGTCTCCGTTTCTGATTTGCTCAAACGTCCCGCAAGCAAAGAAGACATAGGTGGT
GATGAAGATAGTTGTGTTGGATATGAGAAATGGTTTCCAAGTCCGCCGAAAGTGGGGAAGCCTAGATCCGTCTTCAATGC
TGCCTCGCTAGCTTACATAGGCGATTCCATCTACGAGATATACGCTCGTCGCCATTTTCTTTTCCCTCCACTGAGTATTG
AAGAATATAACGACCGTGTTCGAGCAGTGGTGCGATGTGAAGCACAATATGCTTTGCTGCATAAGCTCCTTGATGAGGAT
TTCTTAACTAAAGATGAAAGAGAGATACTTCGGTGGGGAAAAAACGTAGGCTCGGTTAAAACACGGTCAACTAGGCGTGC
TGGTGTTGCGGTTTATAACAAGGCCTCATCATTGGAAACACTTATTGGCTATTTGTATCTAGCAAACGGCAAGAGATTAG
AAGAAATAATGCAGAAGCTGGGGTTCTCAAGTAGTTCTTCAACAGAGATAATGGTTAAGGAGGCCAAGCACAAACTATCA
GCTTTAAAATAA