Details for Chinese cabbage Locus Brara.H00080

Position : A08 ( 5`- 652942 .. 654473 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00080

Protein [Map View]
MSEEGPKLFTNKPKKKDIIAQLKHVEANGTTVVPPSNPAAAAAASYTMGGAPPPPPPPKESFARRYKYMWPLLLTVNLAV
GGYLFFRTKKKDIDEPASEEIAPKSGSVAAAPVTIEKPVSSAVVVKAREPIPEKQQRELFKWMLEEKRKVKPQNAEEKKR
IDEEKAILKQFIGSKTIPTL*

DNA
ATGAGTGAAGAAGGACCCAAGCTTTTCACTAACAAACCCAAGAAGAAGGATATCATCGCTCAGCTGAAACACGTCGAAGC
AAATGGAACCACCGTTGTTCCTCCATCGAATCCCGCTGCAGCGGCGGCGGCTTCGTACACGATGGGCGGTGCTCCTCCTC
CTCCTCCGCCACCGAAGGAATCGTTCGCTCGAAGGTACAAATACATGTGGCCGCTCCTCCTCACCGTCAATCTCGCCGTC
GGAGGTTACCTTTTCTTTAGGACTAAGAAGAAGGACATAGACGAACCTGCAAGTGAAGAGATTGCTCCTAAATCAGGTTC
AGTCGCAGCAGCTCCTGTTACCATTGAAAAGCCTGTGTCTTCTGCTGTGGTGGTCAAGGCACGCGAGCCAATACCGGAGA
AGCAACAACGTGAGCTCTTCAAATGGATGTTGGAGGAGAAAAGGAAAGTAAAACCGCAAAACGCTGAAGAGAAGAAGAGG
ATTGATGAAGAAAAGGCGATTCTCAAACAATTCATAGGATCCAAAACTATTCCTACTCTCTGA