Details for Chinese cabbage Locus Brara.H00079

Position : A08 ( 5`- 625928 .. 626421 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00079

Protein [Map View]
MTNYSTIPTSSHPSPPIDLEPNLVYFRANYVIAVLVILFLSLIYHPTSLLVLAILVPLVVFNRQSDDRTVMICLSVLTVV
MLLFTHATANVLGAMLTAVVLVLVHAAVRRSDNLFLDEEAVAASEYSGLTSYPSS*

DNA
ATGACGAACTACAGCACCATTCCGACTTCGTCTCATCCATCTCCCCCGATTGATCTCGAGCCGAACCTCGTCTACTTCAG
AGCAAACTACGTCATCGCCGTCCTCGTTATCCTCTTCCTAAGTCTTATCTACCACCCGACCTCGCTCCTCGTCTTAGCCA
TCTTGGTCCCTCTCGTGGTGTTCAACCGCCAGAGCGACGATCGGACGGTCATGATCTGTCTCTCGGTTTTGACCGTCGTT
ATGCTTTTGTTCACGCACGCTACGGCGAATGTTCTCGGAGCGATGTTGACCGCTGTTGTGTTGGTTCTGGTCCACGCGGC
GGTTAGGAGGAGTGATAATCTGTTCTTAGATGAAGAAGCTGTGGCGGCGAGTGAATATTCGGGGCTGACCTCGTACCCTT
CGTCATAA