Details for Chinese cabbage Locus Brara.H00078

Position : A08 ( 5`- 622919 .. 625469 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00078

Protein [Map View]
MIRGKHEKRPSSNGTEKVLVAVKASREISKTALVWALTHIVHPGDCITLVVVVTSRNAGRKLWTLPKFAGDCASVHRKPH
SDAIPEIRSDLTDTCSQMILQLHDVYDPNKVNVRIKIVSGSPCGAVASEAKESQATWVVLDKHLKQEVKRCIDELQCNIV
AIKRSQAKVLRLNLVGSPTTKDAVKENKSRSLGSVGAVVTTPLSSPEVGTPFTGTEAGTSSVASSDLGTSSPIFTAEVKK
DDTNAAQETKISRRSDSETSGNIRGAVSLSRNAPPVPPPLCSICQHKAPVFGKPPRFFSYKELELATKGFSQSNFLAEGG
FGSVHRGVLPEGQIVAVKQHKLASTQGDVEFCSEVEVLSCAQHRNVVMLIGFCIEQSRRLLVYEYICNGSLDAHLYGRHK
DTLEWPARQKIAVGAARGLRYLHEECRVGCIVHRDLRPNNILITHDYEPLVGDFGLARWQPDGELGVDTRIIGTFGYLAP
EYTQSGQITEKADVYSFGVVLIELITGRKAMDISRPKGQQCLTEWARSRLEEYAVEELVDPKLEKRYSETEIICMIHTAS
LCIRRDPHVRPRMSQVLRLLEGDMAVNERFSGRLSTERSQRSVR*

DNA
ATGATCAGAGGCAAACATGAGAAGAGACCAAGTTCGAATGGGACTGAGAAGGTTCTTGTTGCTGTTAAAGCATCTAGGGA
GATTTCAAAGACAGCATTGGTTTGGGCTTTGACACATATTGTTCATCCTGGAGACTGCATAACTCTTGTTGTTGTTGTCA
CTTCTCGCAATGCTGGTCGAAAGCTTTGGACTCTCCCTAAGTTTGCTGGAGACTGTGCAAGTGTTCATAGGAAACCACAT
TCTGATGCAATCCCTGAGATAAGAAGTGACCTCACTGATACTTGTTCTCAAATGATTCTCCAGCTTCATGATGTCTATGA
CCCAAACAAGGTTAATGTTAGGATCAAAATTGTTTCTGGATCACCATGTGGAGCTGTTGCATCTGAGGCCAAGGAATCAC
AAGCAACTTGGGTAGTTTTGGATAAGCACCTTAAGCAAGAAGTGAAGCGGTGCATTGATGAGCTACAATGTAATATTGTG
GCCATAAAGCGTTCTCAAGCAAAAGTTCTGCGGTTGAACTTGGTCGGTTCACCAACAACAAAAGATGCAGTGAAAGAGAA
CAAAAGCAGGTCGTTAGGTTCTGTTGGAGCAGTAGTTACAACTCCTTTGAGCAGTCCTGAGGTTGGCACACCATTCACAG
GTACAGAAGCTGGGACATCATCAGTGGCTAGCTCTGATCTTGGAACATCATCGCCTATTTTCACAGCGGAAGTGAAAAAG
GATGATACTAATGCTGCTCAAGAAACCAAGATTTCAAGGCGGAGTGATTCTGAGACTAGTGGAAACATAAGAGGAGCAGT
TTCACTATCACGAAATGCTCCTCCGGTTCCACCTCCTCTCTGCTCTATATGTCAGCACAAAGCACCTGTATTTGGAAAAC
CACCGAGGTTTTTCTCTTACAAAGAGTTAGAGCTTGCAACAAAAGGGTTTTCACAATCTAACTTCTTGGCGGAAGGAGGG
TTTGGATCTGTTCATAGAGGTGTGTTACCTGAAGGACAGATTGTAGCGGTAAAGCAACACAAACTAGCTAGTACTCAAGG
AGATGTAGAGTTCTGCTCTGAAGTAGAGGTTTTGAGCTGTGCTCAGCATAGAAACGTGGTTATGCTAATTGGTTTCTGCA
TTGAACAAAGCAGAAGACTCTTGGTCTATGAGTACATATGCAATGGTTCATTAGACGCTCATCTATACGGTCGCCATAAG
GATACTTTGGAGTGGCCTGCAAGGCAGAAAATAGCGGTTGGAGCGGCTCGAGGTCTTAGATATCTTCATGAAGAGTGTAG
AGTGGGCTGCATTGTTCACAGAGACTTAAGGCCTAACAATATACTAATCACTCATGACTACGAACCACTGGTTGGAGACT
TTGGTTTAGCGCGGTGGCAGCCTGATGGAGAGCTCGGTGTAGACACACGCATAATAGGAACTTTCGGCTACTTAGCTCCA
GAGTATACTCAAAGTGGTCAGATCACAGAGAAAGCTGATGTTTACTCATTTGGGGTTGTACTTATCGAGCTAATCACGGG
TCGTAAAGCCATGGATATCTCCAGACCAAAAGGACAACAATGTTTAACTGAATGGGCTAGGTCTAGATTAGAAGAGTATG
CGGTTGAAGAGCTGGTTGATCCGAAGCTGGAGAAGAGATATTCAGAGACAGAAATTATCTGTATGATTCATACAGCTTCA
TTGTGTATACGCAGAGATCCGCATGTGCGTCCTCGTATGTCTCAGGTGTTGCGTTTACTGGAAGGAGACATGGCAGTGAA
TGAGAGGTTTAGTGGAAGATTATCGACTGAGAGAAGTCAGAGATCAGTGAGATAG