Details for Chinese cabbage Locus Brara.H00077

Position : A08 ( 5`- 616204 .. 617416 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00077

Protein [Map View]
MASSKVCRLSSKIHSLTQRLSKTTNVHASSIPSPLKSSLPSAATSRINQSFRRLPVELSSCVSLFPLHSAVASARLVSSL
SAESMSWGLVPQGISMPL*

DNA
ATGGCGTCTTCTAAAGTCTGCAGATTATCATCGAAGATACACTCTTTAACCCAGAGGCTTAGCAAGACGACGAATGTTCA
CGCCTCGTCCATACCCTCTCCCCTTAAATCTTCGTTACCATCGGCAGCAACTTCCCGTATCAACCAATCTTTCAGAAGAT
TACCAGTGGAGCTGAGTAGCTGTGTGTCGCTGTTTCCGCTACACAGTGCTGTAGCATCTGCTAGATTGGTATCAAGCTTG
TCTGCTGAATCTATGAGCTGGGGTTTAGTTCCTCAAGGTATTTCAATGCCTTTATGA