Details for Chinese cabbage Locus Brara.H00076

Position : A08 ( 5`- 614574 .. 615153 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.H00076

Protein [Map View]
MAKLIFFLAVQIIFLAAVSSAGDDGEDFARTIDTKLTHFKVYWHDILSGPKPSSIRIKPPVTNSTSYFGGVTMFDNALTA
TGQGFYSGAAQKEFSFLVGMNFAFKTGKYNGSTITILGRNPVLSKVREMPIVGGSGLFRFARGYVEARTKLLNLKNGDAI
VEYSCYVLHY*

DNA
ATGGCTAAGCTCATTTTCTTCCTCGCCGTCCAAATTATCTTCCTCGCTGCCGTATCTTCCGCCGGAGACGACGGGGAAGA
CTTCGCCAGAACCATAGACACCAAACTAACACATTTCAAAGTGTATTGGCACGACATCTTAAGCGGTCCAAAACCAAGCT
CAATCAGAATCAAGCCACCGGTTACAAACTCTACCTCCTACTTCGGAGGAGTCACTATGTTCGACAACGCTTTGACGGCA
ACAGGTCAAGGGTTTTACTCCGGAGCTGCTCAAAAAGAGTTTAGTTTTCTAGTGGGGATGAATTTTGCTTTTAAGACAGG
AAAATACAACGGAAGCACGATCACAATTCTTGGTCGGAACCCTGTGTTGTCGAAGGTTAGAGAAATGCCTATAGTCGGAG
GAAGTGGGCTTTTCCGGTTTGCTAGAGGCTATGTTGAGGCTCGTACAAAACTGCTTAACCTAAAGAACGGTGATGCTATT
GTTGAGTACAGTTGTTATGTTTTGCATTATTGA