Details for Chinese cabbage Locus Brara.G03687

Position : A07 ( 5`- 27169658 .. 27171832 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03687

Protein [Map View]
MSKKATFLPLNLSLSPFLLLLLYLLTLSAVVVHGVQEKKILSVHNNIWSLTKSNEPSSSCLSHNLAKGRESSSTTLGMKH
RGLCSGKTIDWGKKLRRALTLDNLRVQSLQLRIKSMSSTTTDSISETQLPLTSGVKLETLNYIITVELGGKNMTLIVDTG
SDLTWVQCQPCKSCYNQQGPLYDPSVSSSYKTVLCNSSTCQDLVAATSNLDRCGGSNGVEKTTCDYVVSYGDGSYTRGDL
GSESIQLGDTKVENFVFGCGRSNKGLFGGASGLMGLGRSSVSLVYQTMKTFNGVFSYCLPSLEDGASGSLSFGDYKNSTS
VSYTPLVQNPQLRSFYILNLTGATIGGVELESPSFGRGIIIDSGTVITRLPPSIYKAVKTEFLKQFTGFSSAPGYSILDT
CFNLTSYEDVSIPTIKMIFQGDAVLEVDVTGVFYYVNPDASLVCLAFASLSYENEVGIIGNYQQKNQRVIYDTKQEKLGI
AGENCSI*

DNA
ATGTCGAAGAAAGCAACTTTTCTGCCATTGAATCTCTCACTTTCTCCTTTCCTTCTTCTTCTTCTTTATCTTCTTACGTT
GTCTGCTGTAGTTGTTCATGGCGTCCAAGAGAAAAAGATTCTCAGTGTACACAACAACATTTGGTCTCTCACCAAATCAA
ACGAACCTTCCAGTTCATGTCTCTCTCACAATCTTGCAAAAGGAAGAGAATCATCATCCACTACACTGGGGATGAAACAT
AGGGGTCTTTGCTCAGGAAAGACTATAGATTGGGGTAAGAAACTGAGAAGAGCCTTAACTCTTGACAACCTTCGAGTCCA
ATCACTTCAACTCAGAATCAAATCCATGAGCTCAACCACAACAGACTCCATTTCAGAAACTCAGCTTCCACTAACCTCAG
GGGTGAAACTTGAGACACTGAACTACATCATCACAGTTGAACTAGGAGGTAAAAACATGACTTTGATAGTTGACACTGGG
AGTGACTTGACTTGGGTCCAATGCCAGCCTTGCAAGTCATGTTACAACCAACAAGGTCCTTTGTATGACCCATCAGTCTC
ATCTTCCTACAAGACAGTTCTCTGCAACTCATCCACTTGTCAAGACCTTGTAGCAGCTACCAGTAACCTGGACCGTTGTG
GAGGCAGCAATGGTGTTGAAAAGACAACTTGTGACTATGTAGTCAGCTATGGGGATGGATCATACACTCGAGGAGACTTG
GGAAGCGAGAGTATCCAGTTAGGCGACACGAAAGTGGAAAACTTTGTCTTTGGTTGTGGCAGAAGCAACAAAGGTCTGTT
TGGAGGAGCTTCTGGTCTAATGGGTTTAGGAAGAAGCTCAGTTTCTTTAGTCTATCAAACCATGAAAACTTTCAACGGAG
TTTTCTCATACTGCTTACCTTCTCTAGAAGATGGAGCTTCTGGCTCATTGTCTTTCGGTGACTACAAGAACTCAACTTCA
GTCTCCTACACTCCTTTAGTACAAAACCCTCAGCTTCGTTCCTTTTACATTCTGAACCTCACCGGTGCCACCATTGGTGG
TGTGGAGCTTGAATCTCCAAGCTTTGGTAGAGGGATTATAATTGATTCAGGAACGGTTATCACTAGACTACCACCTTCTA
TTTACAAAGCTGTGAAGACAGAGTTTCTGAAACAGTTTACTGGGTTTTCTTCAGCTCCTGGCTATTCAATCTTAGACACT
TGCTTTAACCTCACAAGCTATGAAGATGTAAGCATTCCCACTATCAAAATGATCTTCCAAGGTGACGCTGTGCTTGAAGT
GGATGTCACTGGTGTGTTCTACTATGTCAATCCTGACGCATCTCTAGTCTGCTTGGCCTTTGCAAGTCTGTCATATGAAA
ATGAAGTCGGTATCATCGGAAACTACCAGCAGAAAAACCAGAGAGTAATATATGATACCAAACAAGAGAAGCTTGGCATT
GCAGGAGAAAACTGCAGTATCTGA