Details for Chinese cabbage Locus Brara.G03686

Position : A07 ( 5`- 27166802 .. 27169658 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03686

Protein [Map View]
MANRSEETEHDAVSRRSNQGGMILDLMLKRPIRWLRMLVEELHWSFFFGVIVVYGVSQGLGKGLSKVSTQYYFKDEQMIQ
PSEAQVYVGLIQVPWIIKPVWGLLTDVVPVLGYRRRPYFIFAGVLSMVSMMVLSLHKNLQLGLALSCLVAGSAGVAIADV
TIDACVTQLSISHPTLAADMQSLCGMSSSIGSLVGFSLSGVLVHLFGSKGVYGLLGMTAGLIVVVGLILKESPSRSPGGK
HVNEKFIDAGSAIWKTFQYGEVWRPCLFMLLSAAVSLHIHEGMFYWYTDSKDGPSFSKEAVGSIMSFGAIGSLVGILLYQ
NFLKNFPFRNVVFWALSLSVLSGFLDLILVLRINLKLGVPDYFFIVVDEFVSHMISRIKWLPLLVLSSKLCPAGMEGTFF
ALLMSIEHVGHLLSSWGGGVLLHALKVTRTQFDNLWLVIVIRSLLRVVPIGLVFLIPNVDPSSTILPADMLMHRRSEDVV
ETDKIEMTALLSNEA*

DNA
ATGGCGAACCGATCAGAGGAAACAGAGCACGACGCCGTTTCGAGGCGAAGTAACCAAGGAGGAATGATCTTAGATCTAAT
GTTGAAAAGACCTATACGGTGGCTAAGAATGCTCGTCGAAGAGCTTCACTGGAGCTTCTTCTTCGGCGTGATCGTCGTCT
ACGGCGTAAGCCAAGGGCTGGGCAAAGGTCTCAGCAAAGTCAGCACGCAGTACTACTTCAAAGACGAGCAGATGATACAG
CCTTCTGAAGCTCAGGTCTACGTTGGTTTGATTCAGGTTCCTTGGATCATTAAACCGGTTTGGGGTCTGTTGACCGATGT
TGTACCGGTTCTTGGTTACAGGAGACGACCTTATTTCATATTCGCTGGTGTTCTTAGTATGGTGTCTATGATGGTGTTAT
CTCTGCACAAGAATCTGCAGCTTGGACTGGCGTTGTCCTGTCTTGTGGCGGGAAGTGCTGGAGTTGCTATAGCTGATGTG
ACTATTGATGCTTGTGTAACACAGCTTAGTATAAGCCATCCTACGCTTGCTGCAGATATGCAGAGTCTGTGTGGTATGAG
TTCGTCTATTGGATCCTTGGTTGGTTTCTCCCTTAGTGGCGTTTTGGTTCACTTGTTTGGGTCCAAGGGTGTGTATGGTT
TACTCGGTATGACTGCAGGATTGATTGTTGTGGTTGGGTTGATTTTGAAAGAATCTCCTTCTCGTAGTCCAGGTGGCAAG
CATGTGAATGAGAAGTTTATAGATGCCGGAAGTGCAATATGGAAAACCTTTCAGTATGGGGAGGTGTGGCGCCCATGCTT
GTTCATGTTGTTGTCAGCTGCAGTGAGCTTGCACATTCATGAAGGCATGTTCTATTGGTACACTGATTCAAAGGATGGGC
CTTCCTTCTCTAAGGAAGCAGTTGGATCCATTATGTCTTTCGGTGCAATCGGCTCACTCGTGGGGATACTTCTTTATCAG
AACTTTCTGAAGAACTTCCCTTTCAGGAATGTAGTTTTCTGGGCACTTTCCCTATCTGTCCTGTCAGGGTTTCTGGACTT
GATCCTGGTGCTGCGGATAAATCTGAAGCTAGGTGTTCCTGATTACTTCTTCATTGTGGTAGATGAGTTTGTTTCTCACA
TGATCAGTAGAATCAAGTGGCTACCCTTACTTGTCCTTAGCTCCAAGCTCTGCCCTGCTGGTATGGAAGGCACATTCTTT
GCTCTGCTCATGTCTATTGAACATGTAGGACACCTGTTGTCCTCATGGGGTGGAGGAGTATTGCTACACGCCTTGAAAGT
GACACGTACTCAGTTTGATAATCTCTGGTTGGTTATTGTGATCAGGAGTTTATTGAGGGTAGTTCCAATTGGTTTGGTCT
TTTTGATACCAAACGTTGATCCCAGCTCAACTATTCTTCCGGCTGATATGTTAATGCACAGAAGAAGTGAAGATGTGGTA
GAAACTGACAAGATAGAGATGACTGCTCTCTTAAGTAATGAAGCTTGA