Details for Chinese cabbage Locus Brara.G03681

Position : A07 ( 5`- 27149474 .. 27150551 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03681

Protein [Map View]
MVVDGIVSSPLRRPHVLKKQWEDLGSFSTVFRRHRFLLTAMILLAFLCTIYIYFAVTLGARHLSCSDMTGKEKAICQMGH
VHASFSKGRKLKFF*

DNA
ATGGTTGTTGATGGGATTGTGTCATCACCACTACGTAGGCCACACGTGCTAAAGAAGCAATGGGAGGACTTGGGTAGCTT
CTCTACTGTTTTCCGGAGGCATCGCTTCCTTTTAACCGCTATGATCCTTTTGGCCTTCCTCTGCACCATCTACATCTACT
TTGCCGTCACTTTAGGCGCTAGGCACTTGTCGTGTTCGGATATGACCGGGAAAGAGAAGGCAATCTGTCAAATGGGACAC
GTCCATGCCAGTTTCTCTAAAGGGAGGAAACTGAAATTCTTTTGA