Details for Chinese cabbage Locus Brara.G03676

Position : A07 ( 5`- 27131059 .. 27132834 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03676

Protein [Map View]
MASSDAWMREYNEALKLSEDINGMMSERNSSGVTGPDAQRRASAIRRKITILGTRLDSLQSLLVKVPGKQHVSEKEMNRR
KDMVGNLRSKANQVASALNMSNFANRDSLLGPETKPDDAMNRVSGMDNQGIVGFQRQVMREQDEGLEKLEETVMSTKHIA
LAVNEELTLQTRLIEDLDYHVDVTDSRLRRVQKSLAVMNKNMKGGCSCMSMLLSVLGIVGLALVIWLLVKYL*

DNA
ATGGCGTCTTCTGATGCATGGATGAGAGAGTACAACGAGGCTTTAAAACTCTCTGAGGATATTAACGGCATGATGTCCGA
AAGGAACTCTTCTGGTGTAACGGGTCCTGATGCTCAGCGTCGTGCCTCAGCTATACGGAGAAAGATCACTATTTTGGGGA
CTCGATTAGACAGTCTTCAATCCCTTCTTGTAAAAGTTCCTGGGAAGCAACACGTGTCAGAGAAGGAGATGAATCGTCGC
AAGGATATGGTTGGGAACTTGAGATCTAAGGCGAATCAGGTGGCGTCTGCTTTGAACATGTCGAACTTTGCGAATAGAGA
CAGCTTGCTTGGGCCAGAGACAAAGCCTGATGATGCGATGAATAGAGTGTCTGGTATGGATAACCAAGGCATTGTTGGAT
TTCAACGACAAGTTATGAGAGAACAAGACGAAGGGCTGGAGAAATTGGAGGAAACAGTCATGAGTACCAAACACATAGCT
CTTGCTGTCAACGAGGAGCTCACTCTTCAGACAAGGCTTATCGAAGACTTAGACTACCATGTGGATGTTACCGACTCTCG
CTTACGGCGGGTGCAGAAGAGCCTAGCGGTGATGAACAAGAATATGAAAGGAGGATGCTCGTGCATGTCAATGCTATTGT
CAGTGCTTGGAATCGTTGGTCTTGCTCTTGTCATTTGGCTCCTGGTTAAGTACCTGTAA