Details for Chinese cabbage Locus Brara.G03672

Position : A07 ( 5`- 27108084 .. 27110185 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03672

Protein [Map View]
MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAIPTIKYLMENGSRVVLCSHLGRPKGVTPKFSLKPL
VPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRFYKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST
EGVAKYLKPSVAGFLMQKELDYLVGADKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVAATAIPDGWMGLD
IGPDSIKTFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAVAKQLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTG
GGASLELLEGKPLPGVLALDDA*

DNA
ATGGCGACGAAGAGAAGCGTTGGGACTTTGAAGGAAGCAGATCTGAAAGGAAAGAGCGTGTTCGTGAGGGTTGATCTCAA
CGTTCCTTTGGATGATAACTCCAACATCACCGATGACACCAGGATTCGCGCCGCCATTCCCACCATCAAGTACTTGATGG
AAAACGGATCTAGGGTTGTTCTCTGCAGCCACTTGGGCCGCCCCAAAGGTGTTACACCTAAATTCAGCTTAAAGCCTCTT
GTGCCGAGATTGTCTGAGCTTCTTGGTGTTGAGGTTGTGATGGCAAATGACTCTATTGGTGAGGAAGTCCAGAAACTGGT
TGCAGGACTACCTGAAGGTGGTGTTCTTCTCTTGGAGAATGTTAGGTTCTACAAGGAAGAAGAGAAGAACGACCCTGAAT
TCGCAAAGAAGCTTGCTGCCCTTGCTGATGTCTACGTCAACGATGCTTTCGGCACTGCTCACAGAGCTCATGCTTCCACT
GAGGGAGTTGCCAAGTACCTGAAGCCTTCCGTCGCTGGTTTCCTCATGCAGAAGGAACTTGATTACCTTGTCGGAGCTGA
CAAGCTTGACTTGGCCAAGTCGCTCATGGAGAAGGCCAAAGCCAAAGGTGTCTCTCTGTTGCTACCGACCGATGTGGTCA
TTGCTGACAAGTTCGCTCCCGATGCCAACAGCAAGATAGTGGCAGCCACGGCAATCCCAGATGGCTGGATGGGACTCGAT
ATTGGTCCAGACTCCATCAAGACATTCAGCGAAGCTCTGGACACGACCAAAACCATCATCTGGAATGGTCCCATGGGTGT
ATTTGAATTCGATAAGTTTGCAGCTGGAACTGAGGCCGTAGCAAAGCAGCTTGCGGAGCTGAGCGGAAAGGGAGTGACCA
CAATCATAGGAGGAGGTGACTCTGTGGCTGCCGTTGAGAAGGTGGGTTTGGCAGACAAGATGAGCCACATCTCTACTGGA
GGTGGTGCCAGTTTGGAGCTTCTGGAGGGAAAGCCACTTCCAGGAGTCCTCGCTCTCGACGACGCTTGA