Details for Chinese cabbage Locus Brara.G03670

Position : A07 ( 5`- 27103517 .. 27106586 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03670

Protein [Map View]
MNMETTKEQHLGVSGQDYIVDLLPNDDDDHSSPPSSWRLSLDTFRLPSSSPLSSRRTRLSRYLRTPKKERKVSEYYKKQE
KLLEGFNEMETINETGFVSGAPSEEELKKLAKSERLAVHISNAANLVLFVAKAYASVESRSMAVIASTLDSLLDLLSGFI
LWFTANAMSKPNHFHYPIGKRRMQPVGIIVFASVMATLGLQVLLESTRLLVSKKGPNMSSAEEKWMIGIMASATVVKFLL
MLYCRSFQNEIVRAYAQDHLFDVVTNSVGLATAVLAVKFYWWIDPSGAILIALYTISTWARTVLENVHSLIGRSAPPDFL
AKLTFLIWNHHEKIKHIDTVRAYTFGSHYFVEVDIVLPEDMRLHEAHNIGETLQEKLEQLSEVERAFVHIDFEFTHRPEH
KYK*

DNA
ATGAATATGGAGACGACGAAGGAGCAGCATCTCGGCGTTAGTGGACAAGACTACATTGTCGACCTTTTGCCGAACGATGA
CGATGACCACTCGTCTCCACCGTCTTCGTGGCGTCTCAGCCTCGACACGTTCCGCCTCCCTTCTTCTTCCCCCTTGTCCT
CTCGCCGTACTCGCTTGTCCCGTTATCTCCGGACTCCAAAAAAGGAACGTAAAGTCTCTGAGTATTACAAGAAGCAAGAG
AAGCTGCTTGAGGGTTTCAATGAGATGGAAACAATCAACGAAACTGGTTTTGTCTCTGGAGCTCCATCTGAGGAAGAGCT
GAAGAAGCTTGCCAAGAGCGAGAGGCTTGCAGTACACATCTCAAACGCAGCGAACCTTGTGCTCTTTGTAGCCAAAGCTT
ATGCTTCCGTGGAGAGTAGATCTATGGCTGTGATTGCTTCAACTTTGGACTCTCTCTTGGATCTCTTGTCTGGTTTTATC
CTGTGGTTTACTGCAAACGCCATGAGCAAACCAAACCATTTTCACTATCCTATCGGTAAACGAAGGATGCAACCTGTGGG
GATCATTGTGTTTGCATCTGTCATGGCAACTCTTGGGCTACAAGTGTTGCTAGAGTCAACAAGGCTACTTGTTTCCAAGA
AAGGTCCTAATATGAGTAGCGCCGAGGAAAAATGGATGATTGGAATAATGGCATCTGCTACAGTCGTCAAGTTTCTTCTC
ATGCTTTACTGCAGGAGTTTTCAAAACGAAATCGTCAGAGCCTATGCACAAGACCACCTCTTTGACGTTGTCACCAACTC
GGTGGGTTTAGCAACAGCTGTCTTGGCTGTGAAATTCTACTGGTGGATTGATCCCTCTGGTGCTATTCTCATTGCTTTGT
ATACAATCAGCACATGGGCAAGAACGGTGCTAGAAAATGTTCATTCGCTTATTGGACGCTCTGCACCGCCAGATTTCTTG
GCGAAGCTAACGTTCTTGATATGGAACCATCATGAGAAGATTAAACACATTGATACAGTGAGAGCCTACACGTTTGGGTC
ACACTACTTTGTTGAAGTTGATATTGTTTTGCCAGAGGACATGAGGCTACACGAAGCTCACAACATCGGAGAGACTCTTC
AGGAGAAGCTAGAGCAACTCTCTGAGGTCGAGAGGGCTTTCGTTCATATTGACTTTGAGTTCACTCATCGTCCCGAACAC
AAGTACAAGTAA