Details for Chinese cabbage Locus Brara.G03668

Position : A07 ( 5`- 27094665 .. 27097081 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03668

Protein [Map View]
MTSFEDGFPAEKLFSQGYSYTYDDVIFLPHYIDFSTDAVSLSTRLSRRVPLSIPCVSSPMDTVSESHMAAAMASLGGIGI
VHYNSDIAAQASVIRQAKSLRHPIASDAGVKLPEYEITSLDAFGPSSFVFVTQSGTMTVPKLLGYVTKAQWKKMNYEQRE
MKIHDYMKSCEGSEYCLPWDIDIEKIEALLEDKQKGFVVLERDGETVNVVTKDDIERVRGYPKSGPGTVGADGEWMVGAA
IGTRESDKERLEHLIKAGANVVVLDSSQGNSIYQLEMIKYVKKSYPELDVIGGNVVTSYQAQNLIQAGVDGLRVGMGSGS
ICTTQEVCAVGRGQATAVYKVCSLAAQSGIPVIADGGISNSGHIVKALVLGASTVMMGSFLAGSTEAPGAYEYKNGKRIK
KYRGMGSLEAMTKGSDQRYLGDKTNLKIAQGVVGAVADKGSVLKLIPYTMHAVKQGFQDLGASSLQSAHDLLRSNVLRLE
TRTGAAQIEGGVHGLVSYEKRSF*

DNA
ATGACGTCTTTCGAAGATGGGTTCCCGGCGGAGAAGCTCTTCTCTCAGGGATACTCCTACACATACGACGACGTCATCTT
CCTCCCTCACTACATCGACTTCTCCACCGACGCCGTCTCTCTCTCCACGCGCCTCAGCCGGCGCGTGCCCCTCTCCATCC
CCTGCGTCTCCTCTCCGATGGACACCGTCTCGGAGTCTCACATGGCCGCAGCGATGGCCTCCCTCGGCGGGATCGGGATC
GTCCACTACAACTCCGACATCGCCGCTCAGGCGTCGGTGATCCGACAAGCCAAGTCGCTGCGTCATCCGATCGCTTCCGA
CGCCGGCGTGAAGCTCCCGGAGTACGAGATCACTTCGTTGGATGCCTTTGGTCCTTCCTCCTTCGTCTTCGTCACGCAAT
CAGGAACAATGACGGTTCCGAAGCTGTTAGGCTACGTCACGAAAGCTCAGTGGAAAAAGATGAACTACGAGCAAAGAGAG
ATGAAGATTCACGATTACATGAAGAGCTGTGAAGGCAGCGAATATTGTCTACCATGGGACATTGACATTGAGAAGATCGA
AGCTTTGTTAGAAGATAAGCAGAAGGGCTTTGTGGTTCTCGAAAGGGACGGTGAGACTGTGAACGTGGTGACGAAAGACG
ATATAGAGAGGGTTAGAGGGTATCCCAAGTCAGGGCCAGGGACGGTAGGTGCAGACGGTGAGTGGATGGTTGGTGCGGCG
ATAGGGACGAGGGAGTCTGATAAGGAGAGGCTGGAGCATTTGATTAAAGCTGGGGCTAATGTTGTGGTGTTGGATAGTTC
TCAAGGGAACTCTATTTACCAGCTTGAGATGATTAAGTATGTGAAGAAGAGTTATCCTGAGTTGGATGTGATTGGTGGTA
ACGTTGTGACGAGTTACCAGGCGCAGAACTTGATTCAGGCTGGTGTTGATGGGTTGAGAGTTGGTATGGGTTCTGGTTCG
ATATGTACCACACAAGAGGTTTGTGCGGTTGGTCGTGGACAGGCTACTGCTGTGTACAAGGTTTGTTCACTCGCTGCTCA
GAGCGGTATTCCGGTTATAGCGGATGGTGGTATCTCAAACTCAGGTCACATTGTCAAAGCTCTAGTCCTTGGAGCATCAA
CTGTTATGATGGGAAGCTTCTTAGCCGGAAGCACTGAGGCTCCTGGGGCTTATGAGTATAAGAATGGTAAGAGGATCAAG
AAGTACCGTGGAATGGGATCATTAGAAGCAATGACTAAAGGAAGTGATCAGAGATACTTAGGAGACAAAACAAACCTCAA
GATTGCTCAAGGAGTGGTTGGTGCAGTTGCGGATAAAGGCTCAGTGTTGAAGTTGATACCTTACACAATGCACGCAGTGA
AGCAAGGCTTTCAAGACCTTGGCGCTTCTTCCTTGCAATCTGCTCATGATCTGCTGAGATCTAACGTCCTCAGGCTCGAG
ACTCGAACCGGTGCAGCACAGATCGAAGGAGGAGTTCATGGTCTGGTTTCTTATGAGAAGAGATCGTTTTAA