Details for Chinese cabbage Locus Brara.G03665

Position : A07 ( 5`- 27080790 .. 27082187 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03665

Protein [Map View]
PSSDLFKTASYSLTFLHHIRFLESSVREREKESHRERMFHAKKPSSMNGSYENRAMCVQGDSGLVLTTDPKPRLRWTVEL
HERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRLGKQPHKEYGDHSTKEGSRASAMDIQRNVASSSGMI
SRNMNEMQMEVQRRLHEQLEVQRHLQLRIEAQGKYMQSILERACQTLAGENMAAAVAAGGGYKTNLGSTSLSAAVGPQPL
PLSFPPFQDLNIYGNTTEQVLDQHNFHHQNIENHYTANNAADTNIYLGKKRPN

DNA
CCGTCATCTGATCTCTTCAAAACCGCATCGTATTCTCTCACATTTTTGCATCACATTCGTTTCCTTGAATCCTCTGTTAG
AGAGAGAGAGAAAGAAAGTCATAGAGAGAGAATGTTCCATGCTAAGAAACCTTCAAGTATGAATGGTTCATATGAGAACA
GAGCTATGTGCGTTCAAGGAGATTCAGGCCTTGTCCTCACCACCGACCCTAAACCGCGTTTGCGTTGGACTGTCGAACTC
CACGAGCGTTTTGTCGACGCCGTCGCTCAGCTCGGCGGCCCAGATAAAGCGACTCCAAAGACGATTATGAGAGTTATGGG
TGTGAAGGGTCTTACTCTTTACCACCTAAAGAGCCATCTTCAGAAATTCAGGCTTGGAAAGCAGCCGCACAAGGAGTACG
GGGATCACTCCACAAAGGAAGGCTCAAGAGCTTCTGCCATGGATATTCAGCGCAACGTAGCTTCCTCCTCTGGCATGATC
AGCCGCAACATGAATGAGATGCAAATGGAAGTCCAGAGAAGGTTGCATGAACAGCTAGAGGTGCAGAGACATTTGCAGCT
GAGGATTGAAGCTCAAGGAAAGTACATGCAATCTATATTGGAGAGAGCTTGCCAAACCTTAGCCGGTGAGAACATGGCAG
CCGCTGTCGCCGCCGGAGGAGGTTACAAAACCAATTTGGGAAGTACAAGTCTTTCCGCAGCGGTGGGTCCACAACCTCTT
CCTCTTAGTTTCCCGCCGTTTCAAGACCTAAACATTTATGGAAACACAACCGAACAAGTTCTTGACCAACATAACTTCCA
TCATCAGAACATAGAGAATCATTACACAGCCAACAATGCTGCAGACACCAACATTTACTTGGGGAAGAAGCGACCAAAC