Details for Chinese cabbage Locus Brara.G03664

Position : A07 ( 5`- 27073980 .. 27076874 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03664

Protein [Map View]
MSNSKSYWRKQRWGTPPQTLTPLMEGPDPDMQDERAKKESSWEAIREWFKVHKGISGNMSSPSVQPHCNSYDVAAKGQDV
RLLLGVLGCPLAPISVVGSDLLPDDPLLGSFQIKNVPFETSTAHYIIQQYLAATGCLKRAKAAKNMYATGIMKMSCCETE
IAAGKSVKTLGGGGNGRSGDSGCFVLWQMHPGMWSLELVLGGTKLISGSDGKTVWRHTPWLGTHAAKGPQRPLRRLIQGL
DPKTTAGLFAKAQCLGERRIGDDDCFVLKVSADRDSLIERNDAGAPAEVIRHALYGYFCQKSGLLIYLEDSHLTRVTTIS
PEDEAVYWETTIGSSIGDYRDVDGVAVAHCGRAVATVFRFGETSLQYSRTRMEEIWRIDDVVFDVPGLSLDSFIPPADIF
EDDNNISTPVYSNVNSR*

DNA
ATGAGCAACTCAAAATCATACTGGAGGAAGCAAAGATGGGGAACGCCTCCACAAACGCTAACACCATTGATGGAAGGACC
AGATCCAGACATGCAAGATGAAAGAGCCAAGAAGGAGAGCTCATGGGAAGCCATTAGAGAATGGTTTAAGGTTCACAAGG
GTATTTCTGGAAACATGTCTTCTCCATCCGTACAACCACATTGCAATAGTTATGATGTGGCGGCCAAAGGACAAGACGTG
AGGCTCTTGCTCGGCGTCTTAGGTTGTCCTCTTGCTCCAATCTCCGTCGTCGGCTCCGATCTATTACCCGATGACCCTCT
TCTTGGCTCTTTCCAAATCAAGAATGTCCCATTTGAGACGTCGACGGCTCATTACATAATACAACAATACTTAGCGGCAA
CGGGATGTCTAAAGCGAGCTAAGGCGGCTAAGAATATGTACGCGACGGGGATAATGAAAATGAGCTGCTGTGAGACGGAG
ATAGCCGCCGGAAAAAGCGTTAAGACACTCGGTGGCGGCGGAAATGGTCGGAGCGGAGATAGTGGTTGTTTTGTACTGTG
GCAGATGCACCCTGGGATGTGGTCTCTGGAGCTTGTTCTCGGTGGTACTAAACTCATATCAGGCTCTGACGGTAAAACCG
TTTGGCGCCATACGCCATGGTTAGGTACTCACGCTGCTAAAGGCCCTCAACGTCCACTTCGTCGTCTCATCCAGGGTTTG
GACCCAAAAACAACAGCAGGCCTATTCGCAAAGGCCCAATGCTTAGGCGAGAGAAGAATCGGCGACGACGACTGCTTCGT
ACTCAAAGTATCCGCCGATCGTGACTCACTGATCGAACGTAACGACGCCGGAGCTCCGGCGGAGGTTATACGCCACGCGC
TGTACGGATACTTCTGCCAGAAGAGCGGTCTATTGATCTATTTGGAAGATTCACACCTCACTAGAGTCACGACAATCTCA
CCAGAAGACGAAGCGGTTTACTGGGAGACGACGATAGGAAGTAGCATCGGAGATTACCGCGACGTTGACGGAGTCGCTGT
GGCTCACTGTGGACGCGCTGTTGCTACAGTGTTCCGATTCGGAGAGACGTCGTTGCAGTATAGCAGGACGAGGATGGAGG
AGATTTGGAGGATCGACGACGTCGTTTTCGATGTGCCTGGGCTTTCATTGGATTCGTTTATTCCTCCCGCCGATATATTT
GAAGATGATAACAACATTAGTACTCCTGTTTACAGCAATGTAAATTCCCGTTAA