Details for Chinese cabbage Locus Brara.G03659

Position : A07 ( 5`- 27059637 .. 27062947 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03659

Protein [Map View]
MSTGMGNFLRKLGSGKSKSSRSFRGERTTSSSVSNEPSPSDASLSVSDKINAAKKKYALIPDRFSSLDQVSKALREAGLE
SSNLILGIDFTKSNEWTGKTSFEGKCLHALGETPNPYEKAIFVIGQTLAPFDEDNLIPCFGFGDSTTHDEEVFGFHSDNS
PCHGFEEVLACYRRIAPNLRLSGPTSYGLLIDAAVDIVEKNNGQFHVLVIVADGQVTRGLDMPEGELSQQEKTTIDAIVN
ASSYALSIILIGVGDGPWEDMRKFDDKIPKREFDNFQFVNFTEIMKRDTQQSAKETAFALAALMEIPFQYQAAIELGLLG
KTTGLAKKINPRPPPVPYTPPVRTGQASSDSDEQTQNCPICLTNRKDVAFGCGHMTCGECGSRISNCPICRVLITSRLRL
YT*

DNA
ATGTCTACGGGTATGGGGAATTTCTTACGGAAGTTGGGAAGTGGTAAGAGCAAGAGCAGTAGAAGTTTTAGGGGAGAGAG
AACGACGTCGTCCTCTGTCTCTAATGAACCATCACCGTCTGATGCTTCACTCTCAGTTTCCGACAAGATCAACGCCGCCA
AGAAGAAGTACGCTCTCATCCCTGATCGTTTCTCTTCCTTGGACCAGGTATCAAAAGCACTAAGAGAAGCTGGTCTTGAA
TCATCAAATCTCATTCTCGGAATTGATTTCACAAAGAGCAACGAATGGACTGGGAAAACATCCTTCGAAGGAAAATGTCT
GCACGCTCTTGGAGAAACTCCAAATCCATATGAAAAGGCAATATTTGTAATAGGCCAAACGTTAGCTCCTTTCGACGAAG
ACAACCTCATCCCTTGTTTCGGTTTTGGTGACTCAACGACCCATGACGAGGAAGTGTTCGGTTTCCACAGTGATAACTCT
CCATGTCATGGCTTTGAAGAGGTCTTAGCATGTTACAGGAGAATCGCACCCAACTTACGTTTATCAGGGCCAACGTCGTA
TGGACTGCTTATCGACGCTGCGGTCGACATTGTTGAAAAGAACAACGGACAGTTTCATGTTCTGGTGATTGTCGCTGATG
GGCAGGTAACGAGAGGTTTGGATATGCCTGAGGGAGAACTCAGTCAACAAGAGAAAACAACTATAGACGCCATTGTAAAC
GCAAGCTCATATGCATTGTCGATTATTTTAATCGGTGTTGGAGACGGTCCATGGGAAGACATGAGGAAGTTTGATGACAA
GATTCCTAAGCGTGAGTTTGACAACTTTCAGTTTGTGAACTTTACAGAGATCATGAAGAGAGACACACAACAGTCTGCCA
AAGAAACTGCCTTTGCTCTTGCTGCTCTGATGGAGATTCCCTTCCAGTATCAAGCCGCAATCGAACTCGGCTTACTCGGG
AAAACGACGGGCTTAGCCAAGAAAATAAACCCAAGGCCACCACCTGTTCCTTACACGCCTCCAGTTCGCACTGGACAAGC
ATCATCTGACTCAGACGAACAAACTCAGAACTGCCCTATTTGTCTGACTAACCGAAAAGACGTGGCTTTTGGCTGTGGTC
ACATGACTTGTGGAGAGTGTGGATCCAGGATATCAAACTGCCCCATCTGCAGAGTACTGATCACAAGCCGGCTAAGGCTT
TACACGTGA