Details for Chinese cabbage Locus Brara.G03656

Position : A07 ( 5`- 27042883 .. 27048471 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03656

Protein [Map View]
MGYMVRLGLWGAGTSFSDFSKFLGALDKGGVGALELVAMDMKARGMYVCRTLSYKGAEFEIVEAPLEAGMEAMYNKSAEF
WAELRIEMLSANAFLPNEKPNSSQLWRLYWSSHQRFFRHLCMSAKVPVTVRLAKKALLANKCVVIGLQSTGEARTEEAVT
KYGVELDDFVSGPRELLLKFVEENYPLPEQPEPLSEDDSVKELHRKRHSASPGVSVRGRVRKMAKWKQDSDDESYLESEA
ESADDSNDSDDEFQICQICSGEDERKKLLHCSECDKLFHPDCVVPPVTDLPSEAWICYSCKEKTEEYIQARRVYIAELQK
RYEAALERKLKILEIIRSLNLPNNPLDDIVDQLGGPDKVAEITGRRGMLVRASNGKGVTYQARNTKDITMEMVNMHEKQL
FMEGKKFVAIISEAGSAGVSLQADRRAANQRRRVHLTLELPWSADRAIQQFGRTHRSNQTSAPEYRLLFTNLGGERRFAS
IVAKRLETLGALTQGDRRKNIISKYSVVYYCRAGPSLSAYNYDSNFGKKSLMVMYRGIMEQEKLPVVPPGCSTDEPETIK
EFLTKARAALIAVGIVRDSVLANGKDTGKLSGRIIDSDMHDVGRFLNRLLGLPPDIQNRLFELFTSILDVLVHNARIEGT
FDSGIVDMKANSVELLTTPKTVHVDQMSGASTMLFTFTLDRGITWESASSMLEGKRRDGLGSASDGFYESKREWLGRRHF
ILAFESTASGLFKTVRPAVGESIREMSLSELKTKYRKLSSLEKARNGWEDEYEVSSKQCMHGPKCKLGEYCTVGRRIQEV
NVVGGLILPIWGTIEKALSKQVIPLQNFSNALFGFGANLTVLFVQARQSHKRIRVIRIETTTDNQRIVGLSIPNAAVETV
LQDLAWVQEIDD*

DNA
ATGGGCTATATGGTCAGGCTTGGACTTTGGGGAGCTGGAACAAGTTTCAGTGATTTTAGCAAATTTCTAGGTGCGCTTGA
TAAAGGTGGAGTAGGAGCTTTGGAATTGGTTGCCATGGACATGAAAGCGAGGGGGATGTATGTATGCCGTACCCTGAGCT
ACAAAGGGGCTGAGTTTGAGATTGTTGAAGCTCCTTTAGAAGCAGGAATGGAGGCAATGTACAATAAGTCTGCAGAATTT
TGGGCAGAGCTACGGATAGAGATGTTGTCAGCAAATGCTTTTCTCCCTAACGAGAAACCAAATTCTAGTCAATTGTGGAG
ACTATACTGGTCAAGCCATCAGCGTTTCTTTAGACACTTGTGTATGTCAGCTAAAGTTCCTGTAACTGTAAGGTTAGCTA
AGAAAGCCTTATTAGCAAACAAGTGTGTGGTTATTGGCCTTCAGAGTACCGGAGAGGCTCGAACTGAAGAGGCTGTAACT
AAATATGGTGTTGAGCTTGATGATTTTGTCTCGGGACCTCGAGAGCTCCTGTTGAAATTCGTGGAAGAGAATTATCCCCT
GCCAGAGCAGCCCGAACCTCTCTCAGAGGATGATAGTGTTAAAGAACTTCATAGGAAGAGGCATTCAGCTTCACCTGGTG
TCTCAGTTAGGGGGAGAGTAAGAAAGATGGCAAAGTGGAAACAAGATAGTGATGATGAAAGTTATTTGGAGTCCGAAGCT
GAGTCTGCTGATGATTCTAATGATTCTGATGATGAGTTCCAGATATGTCAGATATGCAGTGGGGAAGATGAAAGGAAGAA
GTTGCTCCATTGTTCAGAATGTGACAAGCTTTTTCATCCAGATTGTGTAGTTCCTCCAGTTACAGACTTACCATCTGAAG
CATGGATATGCTATTCTTGCAAGGAAAAAACAGAGGAGTACATTCAAGCAAGGCGTGTCTACATTGCGGAATTGCAGAAA
AGGTATGAAGCAGCATTGGAACGAAAATTAAAGATTTTAGAGATTATCCGGTCTCTGAATCTTCCAAACAATCCCTTAGA
TGATATCGTCGATCAGCTTGGAGGCCCTGACAAAGTCGCAGAAATAACAGGCAGGCGAGGTATGCTTGTAAGAGCGTCTA
ATGGGAAAGGTGTTACATATCAAGCAAGAAACACAAAGGATATAACAATGGAAATGGTCAACATGCACGAGAAACAACTG
TTTATGGAGGGCAAAAAGTTTGTTGCCATTATTTCTGAGGCTGGTTCAGCTGGAGTTTCGTTGCAAGCAGATAGAAGGGC
AGCAAATCAGAGACGAAGGGTTCATTTAACATTGGAGCTTCCTTGGAGTGCTGATCGTGCGATTCAGCAATTTGGAAGAA
CTCACCGGTCAAATCAGACATCTGCACCTGAATACAGGCTACTTTTCACAAATCTTGGTGGGGAACGCCGCTTTGCCTCT
ATTGTTGCAAAGAGACTAGAAACTCTTGGTGCTTTAACACAGGGAGATCGCAGGAAAAATATTATCTCAAAATATAGTGT
GGTGTATTATTGCAGGGCCGGGCCTTCTTTGAGTGCTTACAATTATGATAGTAACTTTGGTAAGAAGTCCTTGATGGTGA
TGTATAGAGGGATAATGGAGCAGGAGAAATTACCCGTTGTTCCTCCTGGCTGCTCGACTGATGAACCGGAAACAATTAAA
GAGTTCTTAACCAAGGCAAGGGCTGCGCTTATTGCTGTAGGAATTGTTAGGGACAGTGTTTTGGCTAATGGAAAAGACAC
TGGAAAGTTATCAGGACGCATTATTGATTCTGACATGCATGATGTTGGACGATTTCTGAATCGCCTCTTGGGATTGCCAC
CTGATATTCAGAATAGGCTGTTTGAATTGTTTACGAGTATATTAGATGTTCTTGTACATAATGCTCGCATTGAAGGAACT
TTTGATTCGGGAATTGTGGATATGAAAGCTAATAGCGTTGAGCTGCTGACCACTCCAAAGACCGTCCATGTCGATCAAAT
GTCTGGTGCATCCACTATGCTCTTTACTTTCACTCTAGATCGTGGTATTACATGGGAGTCTGCAAGTTCAATGCTAGAGG
GTAAGAGAAGGGATGGGCTTGGTTCAGCTAGTGATGGCTTTTATGAATCTAAAAGGGAATGGTTAGGAAGACGGCACTTC
ATATTAGCATTTGAGAGTACGGCCTCTGGGTTGTTTAAGACTGTCCGTCCTGCGGTAGGAGAGTCGATCAGAGAGATGTC
TCTTTCAGAGTTGAAAACTAAATACCGAAAACTCTCATCTCTGGAGAAGGCTCGTAACGGTTGGGAAGACGAGTACGAAG
TTTCATCTAAACAGTGTATGCACGGACCAAAGTGTAAGCTGGGAGAGTATTGCACAGTAGGAAGAAGAATACAGGAAGTA
AACGTTGTGGGTGGCCTCATTCTTCCCATCTGGGGAACCATTGAGAAAGCTCTTTCCAAACAAGTAATCCCTTTGCAGAA
TTTCTCAAACGCTCTCTTTGGTTTTGGCGCGAACCTTACAGTGCTTTTTGTGCAGGCCCGTCAAAGCCACAAGAGAATCA
GAGTGATACGCATAGAGACGACGACTGATAATCAGCGAATAGTGGGACTCTCTATCCCTAATGCAGCTGTAGAAACTGTT
TTACAAGATTTAGCATGGGTTCAAGAGATCGATGATTGA