Details for Chinese cabbage Locus Brara.G03651

Position : A07 ( 5`- 27018102 .. 27031140 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03651

Protein [Map View]
MPLFMPDDELARLSSDAASVVAERADEYIRKLYAELDSVRAKADAASITAEQTCSLLEQKYLSLSRDFASLESQNAQLQS
DLDGRLAELAQSQAEKHQLHLQSIEKDGELERMTTEMSELHKSKRQLMELLEQKDAEISEKNSNIKSYLEKIVKLTDANS
EKESRYAEAGAELARSQAMCSRLSQEKELMERHTKWLDEELTAKVDSYAELRRRHSDLEAEMSAKLVDVEKNYNECSSSL
NWHKERLRELEAKITSLQEELSSCKVAAATMEEQYNAELSTTNKLFELYKESSEEWSRKAGELEGVVKALEARLIQVESG
YKDSLEKEMSTNQQLEKENEDLKQKLEKLEAEIEKTRKTNELTLLPFSSFTRGADDSGTSNMIEESHAIISKVPAGVSGT
ALAASLLRDGWSLAKIYEKYQEAVDAMRHEQLGRKEAELILQRVLSELEEKAEFIQEERGEHERLVEAYSLVNQKLQDSV
SEQSNMEKYIMELKADLRRRERENILSQKDISDLQKQVTILLKECRDVQLRCGAARDDEEDDAQLSDVEMEMESEADKII
SEHLLKFKDINGLVEQNVKLRNLVRSLSEQIESREMELKEMFETELKKKTDEASSKVAIVLKRAEEQGQMIESLHTSVAM
YKRLYEEEQKRYSSNSRSSDLPPVPGRNNFLHLLEDSQEATKRAQEKTFERIRSLEEDLAKARSEIIAIRSERDKLAMEA
NFVREKLEGIMKESERKREEMNGVLARNIEFSQLIIDHQRKLRESSESLHAAEDISRKLSMEVSVLKQEKEVLSNAEKRA
SDEVSTLSQRVYRLQATLDTIQSTEEVREEARAAERRKQEEHIKQLEKEWAEAKKELQEERSNSRNSTSDRNQTLNNAVM
QVEEMGKELANALKAVSAAESRASVAEARLSDLEKKIRSSDPKGLDMDSGGVVSLSDNEMSVELRTAKEEMEKLRGDVES
SKSHMLQYKSIAQVNEIALKQMESAHENFRLEAEKRQESLEAELVSLRERVSELENDCLQKSEQITNAAAGKEDALVSAS
AEIASLREESLVKSSQIEAMNIQMSTMKDDLGKEHEKWCVAQRNYERQVILQSETIQELTKTSQALASLQEEASELRKLA
DSRGTEISELNSKWSEEKCMLEQQKNQAEKMYHELNEQNKLLHSRLEAMHLRSAEKDSRSGNLSSGSIDSDQLGDSGLQS
VVNYLRRTKEIAETEISLMRQEKLRLQSQLESALKMAESARGSLNAERASTRASLLTEDEIKSLQLQVSEVNLLRESNMQ
LREENKHNFEECQRLREVAQKAKTDSENLENLLKQKQTELDLCISEMERLRKESDLEKKRVDELRETYKNIDVADYNRLK
VEVRQLEEKLKAKDNHIEGFKKLLLEKQNKISQLEKDLTNCKNDLSEREKDLTRCKAELSEKEKTLDSSQQAQATMESDS
EKLKAEITRVKRSYTFMKKKLEKERDDLNSDNQSLSKQLEEAKEAGKRTTTDATVEQAVKERDEKEQKIQILDKYLHSLK
DDLKKKDDELTKEKTERKSVEKVLEDSLANIKKEKTKVDEELVKLERYQTALANLSEELDKLKQADGNLPEGTSAVQVLS
GSVLNDQAAAYVSAVDSFERVARTFVLNSQGSTKSTDMVTEASPATVEPSATARASSSKAPVATTQQQLKVKRLTLQKPN
AELRRGRIIRPQLGKPEEPPQVDTEMPEAEGAGGEGKQPSSNVTESQGTTVVPPVQTHVRKRQADSLASEPPQATQGEAS
TEIVPPAFKKAKGSETEPDTTEGENLSKEPDMDETMDATNAAEDDNEETEAETADEETMEAQQETEAEEGQDKTDEPVEE
NPTKTETIPTEEEFKDQTEQENQDLADAEFDKEEGELDLDTLEDLEEPTDVATTPMQSPIRMETTMEEAETTIEPPLEDV
KNDEGGDVAVEEASDKPNNGNNQQVAETDLKPETTSASATPPTSSTPETEETKRNRSQVAETTVATTVSASTTPASAGAS
ETPETSEETKRAASPSRTINIADKAKEKAAIRQAGVAALGGTRTPSPANRAPSPPAPRGRGRIVNTRGGGRVNSRGGRTT
RGGRGPPPSQP*

DNA
ATGCCCTTGTTTATGCCCGACGACGAGCTCGCGCGGCTCTCCAGCGACGCCGCGTCGGTGGTCGCCGAGCGAGCCGACGA
GTACATCCGCAAGCTCTACGCCGAGCTTGACAGTGTCCGCGCCAAGGCCGACGCCGCTTCCATCACGGCGGAGCAGACGT
GCTCGCTTCTCGAGCAGAAGTACCTCTCGCTCTCTCGCGATTTCGCGTCGCTTGAATCTCAGAACGCGCAGCTTCAGTCC
GATCTCGACGGTAGATTGGCTGAGCTCGCGCAGTCTCAGGCGGAGAAGCACCAGCTTCATTTGCAATCGATTGAGAAGGA
TGGAGAGTTAGAGAGGATGACGACGGAGATGTCTGAGCTTCACAAGTCCAAGAGGCAACTCATGGAGCTGCTGGAGCAGA
AGGATGCTGAGATTAGCGAGAAGAATTCGAATATAAAGAGCTATCTGGAGAAAATCGTTAAGCTCACTGACGCCAATTCG
GAGAAGGAGTCTAGATATGCTGAAGCAGGAGCAGAGTTGGCGCGTTCGCAAGCTATGTGCAGTCGTTTATCTCAGGAGAA
AGAGCTCATGGAGAGGCATACGAAATGGCTTGATGAGGAGTTAACAGCCAAAGTTGATAGTTATGCTGAACTCCGTAGGA
GGCATTCTGATCTTGAGGCTGAAATGTCTGCGAAGCTTGTCGATGTTGAGAAAAATTACAATGAGTGCTCTAGTTCGTTG
AATTGGCATAAGGAAAGACTGAGAGAGCTGGAAGCTAAGATTACTTCACTACAAGAGGAGCTCAGCTCGTGCAAAGTTGC
AGCAGCGACCATGGAAGAGCAATACAATGCTGAACTTTCTACGACGAACAAGCTTTTTGAGCTGTACAAGGAAAGTTCGG
AGGAGTGGTCCAGAAAGGCGGGTGAACTTGAGGGTGTCGTTAAGGCCTTAGAGGCACGCTTGATCCAAGTCGAGAGTGGG
TATAAAGATAGCCTTGAGAAAGAAATGTCTACAAACCAGCAGCTAGAGAAGGAGAACGAAGACCTTAAACAAAAACTTGA
GAAGCTTGAAGCAGAAATTGAGAAAACTAGGAAAACAAATGAGCTAACGCTTTTACCTTTCAGCAGTTTCACAAGAGGGG
CAGACGATTCAGGGACCAGCAACATGATAGAGGAAAGCCATGCAATAATTTCTAAGGTTCCTGCTGGTGTGTCAGGAACG
GCGCTGGCAGCTTCACTCTTACGTGATGGGTGGAGTTTGGCCAAAATTTATGAGAAGTATCAAGAGGCTGTTGATGCAAT
GAGACATGAGCAATTAGGTCGAAAGGAAGCTGAGTTGATACTACAACGGGTTTTATCGGAATTAGAAGAGAAAGCTGAGT
TTATCCAAGAGGAAAGAGGTGAGCATGAGCGTTTGGTTGAAGCTTATTCACTAGTCAATCAAAAACTTCAGGATTCTGTA
TCTGAACAATCAAATATGGAGAAGTACATCATGGAGCTAAAGGCTGACTTGAGGAGACGGGAACGTGAAAATATTCTATC
TCAGAAAGATATATCCGACTTACAGAAGCAGGTAACGATACTACTGAAGGAGTGCCGTGATGTCCAACTCCGCTGTGGAG
CTGCCAGGGATGATGAAGAAGATGATGCTCAGCTTTCTGATGTTGAGATGGAAATGGAATCTGAAGCTGATAAAATTATT
TCAGAGCATCTTTTGAAGTTTAAAGATATAAATGGACTAGTTGAGCAGAATGTTAAGCTCCGAAACCTTGTTCGTAGTCT
CTCAGAGCAGATTGAAAGTAGGGAAATGGAGCTGAAGGAAATGTTTGAGACAGAGCTGAAGAAAAAGACTGATGAAGCTT
CTTCGAAAGTAGCCATCGTGCTCAAAAGAGCTGAAGAGCAGGGTCAAATGATTGAATCACTTCACACATCTGTTGCAATG
TATAAACGACTATATGAAGAGGAACAGAAACGTTATTCATCTAATTCTCGTTCATCAGATTTGCCTCCAGTGCCAGGAAG
GAATAACTTTTTACATCTGCTTGAAGATTCACAGGAAGCTACGAAAAGAGCCCAAGAAAAAACTTTCGAACGCATCCGAA
GTCTGGAAGAAGATTTAGCGAAGGCTAGGAGTGAGATAATAGCGATAAGGTCTGAACGGGATAAGTTGGCCATGGAGGCA
AATTTTGTTAGGGAAAAACTAGAAGGCATCATGAAAGAATCTGAACGCAAGAGAGAAGAAATGAACGGTGTTTTGGCAAG
AAACATAGAGTTCTCGCAGCTGATCATCGATCACCAAAGGAAGTTACGTGAGAGTTCTGAGTCTCTGCATGCAGCGGAAG
ATATTTCTAGAAAATTATCAATGGAGGTTTCGGTTCTAAAACAAGAAAAAGAAGTGTTATCCAATGCTGAAAAACGAGCT
TCTGATGAAGTTTCTACTCTATCTCAGAGAGTTTATCGTCTTCAGGCTACCTTGGATACTATACAGAGTACAGAGGAAGT
TCGTGAGGAAGCAAGAGCTGCTGAGAGAAGGAAACAAGAGGAGCATATCAAGCAACTTGAGAAAGAATGGGCTGAAGCTA
AAAAAGAATTGCAAGAAGAAAGGAGCAATTCGCGAAATAGCACTTCGGACCGCAATCAAACTTTGAACAATGCTGTTATG
CAGGTCGAAGAAATGGGAAAAGAATTGGCTAATGCCTTGAAGGCTGTCTCGGCAGCAGAATCAAGGGCTTCTGTGGCTGA
GGCTAGACTTTCTGATTTGGAGAAGAAGATAAGGTCTTCAGATCCTAAGGGCCTTGATATGGACAGTGGTGGAGTCGTCT
CTCTTTCTGATAATGAGATGTCCGTAGAACTGCGTACTGCAAAGGAAGAAATGGAAAAGTTGAGGGGAGATGTAGAATCT
AGCAAAAGCCACATGCTTCAGTACAAGAGTATAGCCCAGGTGAACGAAATTGCTTTAAAGCAAATGGAATCAGCCCATGA
GAACTTCAGACTTGAGGCTGAAAAGAGACAGGAATCGTTGGAAGCAGAGCTTGTTTCTCTTAGGGAAAGGGTATCAGAAC
TTGAAAACGACTGTCTACAAAAATCTGAGCAGATAACCAATGCTGCTGCAGGAAAAGAAGATGCTCTTGTATCAGCATCA
GCTGAAATTGCGAGTCTGAGAGAAGAAAGCTTAGTTAAAAGTTCCCAAATCGAAGCAATGAATATCCAAATGTCCACTAT
GAAGGATGACTTAGGGAAGGAACATGAAAAATGGTGTGTTGCTCAGAGAAATTATGAAAGACAGGTTATTCTGCAGTCTG
AAACTATTCAAGAGCTGACGAAAACATCGCAGGCTTTGGCTTCCCTTCAAGAGGAGGCATCTGAACTACGTAAATTGGCT
GATTCAAGGGGAACGGAAATTTCCGAGCTTAACTCCAAGTGGAGTGAAGAGAAATGTATGCTAGAGCAGCAAAAGAATCA
AGCGGAGAAGATGTATCATGAACTTAATGAACAGAACAAATTACTGCATAGCCGACTTGAGGCTATGCATCTTCGCTCGG
CTGAGAAAGATAGCCGTTCTGGAAACCTATCATCTGGAAGCATTGACTCGGATCAACTTGGAGATTCTGGTTTGCAAAGT
GTAGTCAATTATTTGCGCAGAACAAAGGAAATAGCTGAAACAGAAATATCACTTATGAGACAGGAAAAATTACGGTTGCA
ATCGCAACTTGAGAGTGCCTTGAAGATGGCAGAATCTGCCCGGGGTTCACTTAATGCTGAGCGTGCCAGTACAAGGGCCT
CATTATTGACTGAGGATGAAATCAAATCTCTTCAGCTCCAGGTTAGTGAGGTGAACTTGCTCCGTGAAAGCAACATGCAA
CTCAGGGAAGAAAACAAACACAACTTCGAGGAGTGCCAGAGATTGCGTGAGGTAGCCCAAAAGGCTAAGACGGATTCCGA
AAACTTGGAAAATCTATTGAAGCAAAAGCAAACCGAGTTAGACTTGTGTATAAGCGAGATGGAAAGGCTAAGGAAGGAGT
CCGATCTTGAAAAAAAGAGGGTGGATGAGTTGAGAGAGACTTATAAAAACATTGATGTTGCTGACTACAATCGCCTCAAA
GTTGAAGTGCGGCAACTCGAGGAGAAACTGAAAGCGAAAGATAATCATATTGAAGGTTTCAAGAAGCTTCTGTTAGAGAA
GCAGAATAAGATATCGCAACTAGAGAAGGATCTAACAAACTGTAAAAACGATCTGAGTGAGAGGGAGAAGGATCTAACAA
GATGCAAAGCCGAACTGAGTGAGAAGGAGAAAACGTTAGACTCTTCTCAGCAAGCACAGGCGACTATGGAGTCAGACTCT
GAGAAGCTGAAAGCAGAGATCACAAGGGTCAAGAGATCTTATACCTTCATGAAGAAAAAGCTCGAAAAAGAAAGGGACGA
TTTGAACAGTGATAATCAGTCACTCTCTAAACAGTTAGAGGAAGCCAAAGAGGCTGGAAAGAGAACAACAACTGATGCTA
CGGTGGAGCAGGCCGTTAAGGAGAGAGATGAAAAAGAACAAAAAATTCAGATATTGGATAAATATCTTCATTCACTGAAA
GATGACCTGAAGAAGAAGGATGACGAATTAACAAAAGAGAAAACAGAACGCAAGTCTGTTGAGAAGGTACTTGAAGACTC
CTTGGCCAACATTAAAAAGGAGAAAACAAAAGTGGATGAAGAGCTTGTTAAGCTCGAGAGGTATCAGACGGCATTGGCTA
ACCTCTCTGAAGAATTGGACAAATTGAAGCAGGCGGATGGAAATCTTCCAGAGGGTACTTCAGCTGTCCAGGTTCTCTCT
GGAAGCGTATTGAATGACCAAGCCGCTGCCTACGTATCAGCTGTTGACTCTTTTGAGCGCGTGGCTCGTACTTTTGTCCT
CAATTCTCAAGGTAGCACCAAATCTACCGATATGGTTACTGAAGCTTCCCCTGCTACAGTTGAGCCTTCAGCCACTGCCA
GAGCTTCTTCGTCAAAAGCACCGGTGGCGACTACGCAGCAGCAACTCAAAGTGAAGAGATTGACTTTGCAGAAACCAAAC
GCTGAACTCCGCAGAGGGAGGATTATTCGTCCTCAGCTTGGCAAACCAGAAGAACCTCCGCAAGTTGATACTGAGATGCC
AGAAGCTGAAGGAGCTGGTGGTGAAGGAAAACAGCCTTCCTCCAATGTCACAGAGAGTCAAGGAACCACTGTTGTGCCGC
CTGTTCAGACACATGTCCGTAAACGCCAGGCCGATTCGTTGGCTTCTGAGCCACCGCAAGCGACTCAAGGGGAAGCTAGT
ACCGAGATTGTACCACCTGCGTTTAAGAAGGCAAAAGGATCGGAGACAGAACCAGATACTACCGAAGGTGAAAATCTCTC
TAAAGAGCCAGACATGGATGAAACCATGGATGCTACCAATGCTGCCGAAGATGACAATGAAGAAACAGAAGCTGAGACTG
CAGATGAGGAAACTATGGAAGCACAACAAGAAACTGAAGCTGAAGAAGGGCAGGATAAAACTGATGAACCAGTAGAAGAA
AATCCAACCAAGACAGAAACCATCCCTACCGAAGAAGAGTTTAAGGATCAGACCGAACAAGAGAATCAAGATCTGGCAGA
TGCGGAATTTGATAAAGAAGAAGGCGAGCTCGATCTAGATACACTGGAAGATCTCGAAGAGCCTACGGATGTAGCTACTA
CACCCATGCAGTCACCTATTAGGATGGAGACAACAATGGAGGAAGCTGAAACAACCATTGAACCACCACTAGAAGATGTT
AAGAACGACGAAGGAGGTGATGTAGCTGTTGAAGAAGCCTCTGATAAACCCAACAATGGTAATAATCAACAAGTAGCTGA
AACCGATCTCAAGCCAGAGACCACCTCTGCATCTGCCACTCCACCCACTTCCTCTACTCCAGAAACTGAAGAAACGAAAA
GAAACCGATCTCAAGTAGCAGAGACCACAGTAGCTACAACTGTCTCTGCATCTACCACTCCAGCATCTGCAGGTGCGAGC
GAAACTCCAGAAACTAGTGAAGAAACGAAAAGAGCAGCGTCGCCAAGTAGGACTATTAATATAGCTGATAAAGCAAAGGA
GAAAGCAGCTATAAGACAAGCCGGAGTAGCCGCTTTAGGAGGAACCCGAACTCCCTCACCAGCCAACCGAGCTCCTTCAC
CACCCGCTCCTAGAGGTCGTGGTCGCATTGTAAACACTCGAGGAGGCGGTCGAGTGAATTCTCGTGGTGGCCGAACCACA
CGCGGTGGACGTGGACCACCCCCGAGCCAGCCGTGA