Details for Chinese cabbage Locus Brara.G03647

Position : A07 ( 5`- 27005406 .. 27008072 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03647

Protein [Map View]
MASTLFSRAFLAASRRLITPSLLPETTLNLAAFLSKRSFYSQLGAPSTWARRAMASSGVGGKAGYSTSSVPTNEPVVSVD
WLHSNLREPDLKVLDASWYIPEEKRNSIQEYQVAHVPGALFFDLDGISDRSTSLPHMLPSEEAFAAGCSALGIENKNGVV
VYDAKGIYSAARVWWMFRAFGHNKVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKIYQGQTVSPVTFQTKFQ
QHLVWSLDQVKKNMEDQTHQHIDARSKARFDGTAPEPRKGIRSGHIPGSKCVPFPQLLDSSQTLLPAEEVKKRFEQEEIS
LDKPIMASCGTGVTACILAMGLHRLGKTDVPVYDGSWTEWATEPDLPMEGAESSS*

DNA
ATGGCTTCGACCCTTTTCTCCAGAGCCTTTCTGGCTGCAAGTCGCCGCTTGATTACTCCCTCTCTTCTTCCGGAAACCAC
ACTCAACCTCGCCGCGTTCCTGAGTAAGAGATCATTCTACTCTCAGTTAGGCGCTCCCTCTACATGGGCTCGTCGAGCCA
TGGCTTCTAGTGGAGTTGGGGGGAAAGCTGGATACTCTACATCGTCCGTACCAACCAATGAGCCTGTTGTTTCTGTTGAC
TGGCTCCATTCTAATCTTAGAGAGCCTGATTTGAAGGTTTTGGATGCGTCATGGTATATTCCAGAAGAGAAGCGGAACTC
GATCCAGGAGTATCAGGTTGCTCATGTTCCTGGTGCTCTCTTCTTTGATTTGGATGGAATATCAGATCGGTCAACTAGTT
TGCCACATATGTTGCCGTCTGAGGAAGCTTTTGCTGCTGGTTGTTCTGCTCTTGGGATTGAGAACAAAAACGGAGTGGTT
GTTTATGATGCTAAGGGGATCTATAGTGCAGCCCGTGTATGGTGGATGTTCAGAGCTTTTGGACACAACAAAGTTTGGGT
GCTGGATGGAGGTCTGCCGAGATGGCGTGCTTCAGGTTATGATGTTGAGTCTAGTGCATCAGGTGATGCTATTCTGAAAG
CCAGTGCCGCAAGTGAGGCTATTGAGAAAATTTATCAAGGACAAACCGTCAGTCCAGTAACCTTTCAGACCAAGTTTCAG
CAACATCTAGTGTGGTCACTTGATCAGGTCAAGAAAAACATGGAGGATCAGACACATCAACACATAGACGCACGTTCCAA
AGCCAGGTTTGACGGTACTGCTCCAGAACCTCGTAAGGGAATAAGAAGCGGTCATATCCCTGGAAGCAAATGTGTCCCCT
TTCCTCAGCTGCTTGATTCTTCTCAAACACTCTTACCAGCAGAAGAAGTGAAGAAACGATTTGAACAAGAAGAAATCTCA
CTGGACAAGCCTATTATGGCCTCTTGTGGCACTGGGGTAACAGCTTGCATCCTGGCTATGGGGCTTCACCGACTGGGTAA
AACCGATGTGCCAGTCTATGATGGCTCCTGGACTGAATGGGCAACAGAACCAGACTTGCCCATGGAAGGAGCTGAATCTT
CTTCATGA