Details for Chinese cabbage Locus Brara.G03646

Position : A07 ( 5`- 27003644 .. 27004765 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03646

Protein [Map View]
MHSTGKINLLAFIRLLSTSSSLVRRNHLSATFTTRCSTLCANEAEQRVGGAKLSPLEVLRKWGCNDDEISKLFTSRPALQ
RANVSQLEFKLSLLTPLGITSSDLVKIVTCRPKFFSSRIHLVLDERINYFIDVLGSKEVLRKAIIRNPSLMLYDLDDKIK
PAIDFYRGLGFSQKDLVAMLMSRPTVIPRTSFNKGKLEYIHKTGVTRDSKMFKYVAAIIGVTRMETIQEKVANLEKFGLS
EEEIWGLCGKCPILLTLSVEKVQRNMTFVVATMKLAASSVLKHPFLLLANLETQIRPRVDLVKRVFEMGMKPLVEDVSIA
TALRMSEKRFLKVYVMCHREDVVEELMEFYEKAKNVKRLGVESKKYVRKGFPF*

DNA
ATGCATTCAACGGGGAAGATAAATCTATTAGCTTTCATCAGATTACTCTCCACTAGTTCAAGTTTAGTAAGAAGAAATCA
CTTATCTGCCACCTTCACCACCAGGTGTTCGACGTTATGCGCCAATGAAGCTGAACAACGCGTTGGTGGTGCTAAACTGA
GTCCTTTGGAAGTTCTAAGAAAATGGGGCTGTAACGACGATGAAATCTCAAAGCTTTTCACTAGCAGACCAGCTTTGCAG
AGAGCCAATGTCTCTCAGCTAGAGTTCAAACTCAGCCTCCTTACTCCGTTGGGGATCACATCATCCGACCTCGTGAAGAT
TGTTACTTGCCGTCCCAAGTTCTTCAGCTCTCGTATTCACCTCGTCCTCGACGAAAGAATCAACTACTTCATCGACGTTC
TGGGGTCAAAAGAGGTGTTGCGGAAAGCCATTATTAGGAACCCTTCTCTCATGTTGTATGACCTCGATGACAAGATCAAA
CCCGCTATAGATTTCTACCGAGGGTTGGGGTTTAGCCAGAAGGATCTTGTTGCAATGTTGATGTCTCGTCCCACTGTGAT
TCCAAGAACGAGCTTCAACAAGGGAAAGCTCGAGTACATTCATAAAACTGGGGTCACCAGAGACTCCAAGATGTTTAAAT
ACGTTGCAGCCATCATAGGGGTCACGAGGATGGAGACAATCCAAGAGAAGGTTGCGAACCTGGAGAAGTTTGGGCTATCG
GAAGAAGAGATTTGGGGTCTGTGTGGGAAATGCCCGATCCTTCTGACTTTGTCAGTTGAGAAAGTTCAGAGAAACATGAC
TTTCGTCGTAGCAACGATGAAACTCGCGGCTAGTTCCGTGCTTAAGCACCCGTTCTTGCTCCTCGCCAACCTCGAGACTC
AGATAAGGCCTCGTGTGGATTTGGTAAAGAGGGTCTTTGAAATGGGGATGAAGCCTTTGGTGGAAGATGTGAGCATTGCC
ACAGCGCTGAGGATGAGCGAGAAACGGTTCTTGAAGGTTTATGTGATGTGTCATCGAGAAGACGTTGTAGAGGAGTTGAT
GGAGTTTTATGAGAAAGCTAAAAACGTGAAACGGTTGGGTGTAGAATCTAAGAAGTATGTTCGTAAAGGATTCCCTTTTT
GA