Details for Chinese cabbage Locus Brara.G03645

Position : A07 ( 5`- 27000959 .. 27003296 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03645

Protein [Map View]
MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKIQHLTPNIGVVYSGMG
PDFRVLVRKSRKQAEQYNRLYKEPIPVTQLVRETATVMQEFTQSGGVRPFGVSLLVAGYDDKGPQLYQVDPSGSYFSWKA
SAMGKNVSNAKTFLEKRYTEDMELDDAIHTAILTLKEGFEGEISSKNIEIGKIGADKVFRVLTPAEIDDYLAEVE*

DNA
ATGGGAGACAGTCAGTACTCGTTTTCTCTCACTACGTTCAGCCCATCAGGGAAGCTTGTTCAGATAGAACATGCTCTAAC
AGCTGTTGGATCAGGCCAAACATCTCTGGGAATCAAAGCTTCAAACGGAGTTGTCATTGCAACAGAAAAGAAGCTTCCCT
CTATTTTGGTTGATGAAGCGTCTGTTCAAAAGATTCAGCATTTGACTCCCAACATTGGAGTTGTTTACAGTGGTATGGGT
CCTGATTTCCGAGTTCTTGTACGAAAGAGTAGGAAGCAGGCTGAGCAATATAACCGATTGTACAAAGAACCTATTCCCGT
TACGCAACTTGTAAGGGAAACAGCTACTGTGATGCAAGAGTTCACTCAATCAGGTGGTGTGAGGCCGTTTGGAGTTTCTC
TACTAGTCGCTGGGTACGATGACAAGGGTCCACAGTTGTATCAGGTGGATCCTTCTGGCTCTTACTTCTCATGGAAAGCT
TCGGCAATGGGAAAGAATGTATCGAATGCTAAGACATTTCTTGAGAAGAGGTACACTGAAGACATGGAACTTGATGATGC
CATTCACACTGCCATATTGACATTGAAGGAAGGATTTGAGGGGGAAATCTCAAGCAAAAACATTGAGATTGGCAAAATTG
GTGCTGACAAAGTGTTCAGGGTGCTAACTCCGGCAGAAATCGATGATTACTTGGCTGAAGTCGAGTAA