Details for Chinese cabbage Locus Brara.G03644

Position : A07 ( 5`- 26990721 .. 26992190 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03644

Protein [Map View]
MGSERSSMEKKKRSRARSEDPSSSSENEERVKRHRGTEKDDQRRSRRSEKKKKEKKSHKQHRSSSSKKSKDDKHKKKDAE
GDHKLKEGIAELTSEDYFSKNNEFATWLKEKKRTYFNDLTTESARELFSRFVKAWNRGKLESRYYEGISTAPRTAHNWKI
KQK*

DNA
ATGGGAAGCGAACGGAGCTCGATGGAGAAGAAGAAGAGAAGCAGAGCAAGGAGCGAAGATCCTTCTTCGTCTTCCGAGAA
CGAAGAGAGAGTTAAGAGGCATAGAGGAACAGAGAAAGATGATCAGAGGAGAAGCAGGAGAAGTGAGAAGAAGAAGAAGG
AGAAGAAATCTCACAAGCAACACCGATCAAGTTCATCAAAGAAGTCGAAGGATGATAAGCACAAAAAGAAAGACGCAGAA
GGTGACCACAAGCTAAAAGAGGGGATCGCAGAGCTAACAAGTGAGGACTACTTCTCTAAGAACAACGAGTTTGCCACATG
GCTGAAAGAGAAGAAGCGCACTTACTTCAATGATCTCACGACCGAGTCTGCACGGGAGTTGTTTTCTCGCTTTGTCAAGG
CATGGAACAGGGGGAAACTCGAGTCCCGATACTACGAGGGAATCTCCACTGCTCCACGAACAGCTCACAACTGGAAGATC
AAGCAGAAGTGA