Details for Chinese cabbage Locus Brara.G03643

Position : A07 ( 5`- 26988232 .. 26989618 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03643

Protein [Map View]
MGKGRAPCCDKTKVKRGPWSPEEDLKLISFIQKFGHENWRSLPKQSGLLRCGKSCRLRWINYLRPDVKRGNFSAEEEEMI
IKFHQSYGNKWSKIASKLPGRTDNEIKNVWHTHLKKRLVKSSASPDEPASPCSSDKTQAEDCLNIKTTRDSTTSASSGGS
NNSNQEDDPNISLMFEYSQFNDIIEEVDKPDLLEIPFDSDLDIWSFLDAPNENSSVSRGEEECDEDEVKKWLKHLENELG
LEEDDNHQHHKEGAQDKDSSLLKTYELMIH*

DNA
ATGGGGAAAGGAAGAGCACCTTGTTGTGACAAGACCAAAGTGAAGAGAGGTCCATGGAGCCCAGAAGAAGACTTGAAACT
CATCTCTTTCATTCAAAAGTTTGGTCATGAGAACTGGAGATCTCTCCCCAAACAATCTGGTTTGTTGAGGTGTGGAAAGA
GTTGCCGTCTAAGATGGATTAACTACCTCAGACCAGATGTGAAGCGTGGTAACTTCAGTGCAGAGGAAGAAGAAATGATC
ATCAAGTTTCACCAGAGCTATGGAAACAAGTGGTCGAAAATCGCTTCTAAACTTCCAGGGCGTACAGATAATGAGATCAA
GAATGTGTGGCATACACATCTAAAGAAAAGACTGGTTAAGAGTTCAGCAAGTCCAGATGAACCGGCCTCTCCTTGTTCTA
GTGATAAGACTCAAGCAGAAGACTGTTTGAACATAAAGACAACTCGTGATTCTACTACTTCAGCGTCTTCTGGTGGTTCC
AACAATTCAAACCAAGAAGATGATCCAAATATAAGTCTTATGTTTGAGTATAGCCAGTTTAATGATATTATAGAAGAGGT
GGACAAGCCCGACCTACTGGAGATCCCTTTTGACTCAGATCTTGACATCTGGAGTTTCTTAGATGCTCCAAACGAGAACA
GTTCAGTTTCAAGGGGAGAAGAAGAGTGTGATGAGGATGAAGTCAAGAAATGGTTGAAGCACTTGGAAAATGAACTCGGG
TTAGAAGAAGATGATAATCATCAACATCATAAAGAGGGAGCACAAGACAAAGATTCATCACTCTTGAAGACCTACGAGCT
CATGATACATTAA