Details for Chinese cabbage Locus Brara.G03638

Position : A07 ( 5`- 26964271 .. 26965695 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03638

Protein [Map View]
MFDIMPKPLQYRRCLVSSCLNHFLKKSVFRESENLRLFPVQVRHKSGGGFRPKKKVYHRVHELDKAIDLKKKPSLILQLK
SMIQFQKHGKVLLRDLEKHVGFVHKWNLMAAIEKYPSIFHVGGGNREPPSVMLTEKAQKIAAEESEATESMEPLLVNNLR
KLLMMSVDCRVPLEKVELIQSAMGLPQDFKSNLIPKYPDFFSLKVVNGKVHLVLENWDSSLAITAREERLSRVLDRSENR
KKVRITKDGNFLGPNAFKVSFPPGFRPNASYLEEFEKWQKMEFPSPYLNARRFDSADPKARKRVVAVLHELLSLTMEKRV
TCSQLDAFHSEYLLPSRLILCLIKHQGIFYITNKGARGTVFLKEAYDGSGLIEKCPLLLFQERFVSLCGRREVSVCNDQL
QSSSVIS*

DNA
ATGTTCGATATAATGCCAAAACCATTACAGTACAGAAGATGTTTGGTTTCTTCCTGTCTGAACCACTTTCTGAAGAAGAG
TGTATTTAGAGAAAGTGAAAACTTGAGGCTGTTTCCTGTACAGGTGAGGCACAAGTCGGGTGGAGGATTTAGACCGAAGA
AGAAAGTATACCACAGAGTTCACGAGCTTGACAAAGCCATAGACCTGAAGAAGAAACCATCTCTCATACTTCAACTCAAG
TCAATGATCCAATTCCAGAAACATGGAAAGGTTCTTCTAAGGGACCTCGAGAAGCACGTTGGGTTCGTTCACAAATGGAA
CTTAATGGCTGCCATTGAGAAGTACCCTTCGATATTCCACGTTGGAGGTGGAAACAGAGAGCCTCCTTCTGTCATGCTAA
CCGAGAAAGCTCAGAAGATTGCAGCTGAGGAAAGTGAAGCTACAGAGTCAATGGAGCCTCTTCTTGTCAACAATCTCAGG
AAGTTGCTGATGATGTCTGTTGATTGTCGAGTGCCTCTGGAGAAAGTTGAGCTCATTCAATCCGCAATGGGTTTGCCTCA
GGACTTTAAGAGTAACTTGATCCCCAAGTATCCTGATTTTTTCTCTTTGAAGGTTGTTAATGGGAAAGTTCATCTCGTGT
TAGAGAACTGGGACTCTTCACTAGCAATCACCGCACGTGAAGAGAGGCTATCACGTGTTCTTGATCGAAGTGAGAACAGA
AAGAAGGTTAGGATCACAAAGGATGGTAACTTCTTAGGCCCAAACGCGTTCAAGGTTTCGTTTCCTCCTGGCTTTAGACC
AAACGCGAGCTATCTAGAGGAGTTTGAGAAGTGGCAGAAGATGGAGTTTCCATCTCCTTACCTTAACGCCAGAAGGTTTG
ATTCTGCAGATCCTAAAGCTAGGAAACGAGTTGTGGCCGTGCTTCACGAGCTGCTCAGTTTAACAATGGAGAAGAGAGTG
ACGTGCTCTCAGTTGGACGCATTTCACTCTGAGTATTTGCTTCCTTCGAGACTAATACTCTGCTTGATAAAGCATCAAGG
GATCTTCTACATTACTAACAAAGGTGCAAGGGGTACAGTGTTTCTCAAAGAAGCTTATGATGGTTCTGGTTTGATCGAGA
AGTGTCCTTTGTTATTGTTCCAAGAGAGATTTGTTTCACTCTGTGGTCGGAGAGAAGTGAGTGTGTGTAATGATCAATTG
CAGTCTTCAAGTGTTATCTCCTAA