Details for Chinese cabbage Locus Brara.G03635

Position : A07 ( 5`- 26943773 .. 26945464 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03635

Protein [Map View]
MSTQLNPISSMAAYPSPVGFVSHLPTGFPHFPSVNKGVSRVLASTQITLSPKDSAFTITGSSWKPDDPRSDEPRLNTHFS
HLQSLVTKGQKPNVTHSTQLLYDLCKANRLKKAIRVIELMVTSGVIPDASAYTYLVNQLCKRGNVGYAMQLVEKMEHHGF
PPNTVTHNALVRGLCMLGSLSQSLQFVERLMERGLAPNAFTYSFLLEAAYKERGTDEAVKLLEEIVAKGGEVNLVCYNVL
LTGFCKEGRTDDALKMFREMMPEKGFKPNVVSYNICLRCLCCDGRWEEANELLAEMDGGDKSPSVVTYNILINSLAFHGR
TDQAMEVLSEMGRGVTATSYNPVIARLCKEGKVDLVVKCLDDMIYRRCKPNEGTYNALGALCEGGNDKVREAFYIIQSLS
KRQRCCTHDFYKSVITSLCRKGNTFAAFQLLCEMTRCGFEPDSHTYSALIRGLCNEGMFGGAMEVLSIMEESGLCKPTVD
NFNAMILGFCKIRRTDLALEVFEMMVERRRMPNETTYVIVVEGIAHEGELELAREVLEELRFRKVVGQNAVDRIVMQFNL
DFD*

DNA
ATGTCGACTCAATTGAACCCAATCTCATCCATGGCGGCGTACCCATCTCCGGTAGGGTTCGTCTCCCACCTCCCCACCGG
CTTCCCCCACTTCCCCTCCGTCAACAAAGGCGTCTCCAGAGTCTTAGCTTCGACCCAGATAACGCTATCCCCCAAAGACT
CCGCCTTTACCATCACCGGATCCAGCTGGAAACCCGACGACCCGAGAAGCGACGAGCCAAGACTAAACACCCACTTCTCC
CACCTCCAAAGCCTCGTCACAAAAGGCCAAAAACCCAACGTAACACACTCCACCCAGCTCCTCTACGACCTCTGCAAAGC
CAACAGGCTCAAAAAAGCCATCCGCGTGATCGAGCTAATGGTCACCTCGGGAGTCATCCCCGACGCCTCCGCCTACACCT
ACCTCGTCAACCAGCTCTGCAAGCGAGGCAACGTCGGCTACGCGATGCAGCTCGTCGAAAAAATGGAACACCACGGCTTC
CCTCCCAACACCGTCACTCACAACGCCTTAGTCCGCGGCCTCTGCATGCTCGGGAGCCTCAGCCAGAGCCTCCAGTTCGT
CGAGAGGCTCATGGAGAGAGGCCTAGCTCCCAACGCCTTCACTTACTCCTTCCTCCTCGAGGCTGCTTACAAAGAGCGCG
GCACTGATGAAGCTGTTAAACTCCTGGAGGAGATTGTTGCCAAGGGTGGTGAGGTTAATCTGGTTTGTTACAATGTGCTG
TTGACTGGCTTTTGTAAAGAAGGGAGGACTGATGACGCGTTGAAGATGTTTAGAGAGATGATGCCGGAGAAAGGGTTTAA
GCCTAATGTTGTTAGTTATAATATCTGTTTGAGGTGTTTGTGCTGTGATGGGAGGTGGGAGGAGGCGAATGAGCTGTTAG
CTGAGATGGACGGTGGAGATAAGTCTCCTTCGGTTGTTACTTACAACATTTTGATCAACTCGTTGGCTTTTCATGGTAGA
ACGGACCAGGCCATGGAGGTTTTGAGTGAGATGGGGAGAGGAGTCACTGCAACCAGCTATAACCCTGTGATCGCGCGTCT
GTGCAAGGAAGGGAAGGTTGATCTCGTCGTGAAGTGTCTGGACGACATGATTTACAGACGCTGTAAGCCTAACGAAGGTA
CCTACAACGCGTTAGGAGCCCTGTGCGAGGGTGGCAACGACAAGGTGCGTGAAGCGTTTTACATTATACAGAGTTTGAGC
AAGAGGCAGAGATGCTGCACGCACGATTTCTACAAGAGCGTGATCACGAGCCTGTGCAGGAAAGGCAACACGTTCGCTGC
GTTTCAGCTCTTGTGCGAGATGACTAGGTGCGGGTTCGAACCTGACTCGCATACCTACTCGGCGTTGATCAGGGGGCTGT
GTAACGAAGGGATGTTTGGTGGAGCGATGGAGGTTTTGTCGATAATGGAGGAGAGTGGGTTGTGTAAGCCCACGGTGGAT
AACTTTAACGCGATGATTCTTGGGTTTTGCAAGATAAGGAGGACGGATTTGGCGTTGGAGGTGTTTGAGATGATGGTTGA
GAGGAGGAGGATGCCGAACGAGACGACGTATGTGATAGTGGTTGAAGGGATAGCTCATGAGGGTGAGCTGGAGCTGGCTA
GAGAGGTTCTTGAGGAGCTGAGGTTCCGTAAGGTTGTCGGGCAGAATGCAGTAGATAGGATTGTGATGCAGTTTAATTTA
GATTTTGATTGA