Details for Chinese cabbage Locus Brara.G03631

Position : A07 ( 5`- 26925487 .. 26929927 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03631

Protein [Map View]
MEDIGLVKQGWNWMQSQKHMCSNACSAVRRFGEKIGELVERHWPLVCSGCGKLLGLLRLGIVYWKDCILRGFRCSAKLGS
AALLLIMWSCFLSLTSLSCLLYVLLSMGAAAAVVLNLGCTPGLFIVGLFGILILWMYANFWITGTLFIVGGYLFSLNHAR
LVVLIAAGYAMYCVKVRLGWLGVLLSMNLAFLSNDVLNCLLQWCDNLSEKPQPEEPKKSEETIIEEDYPGEFEYPSVPVE
EEEEEKTEKKVHENKSSAEPTAPTTTVVNTVREITSVKMVKVDTSSSADEMKRILKSLNHYEALGFSRHKKIDDAVLKKE
YRKKAMLVHPDKNMGSPLASESFKKLQCAYEVLSDIVKKRDYDEQLRKEESRTRSVCQTSHASSHQSGAGYRAEESRRIH
CTKCGNSHIWVCTSRTKAKARWCQDCGQYHQAKDGDGWVELKGTLPFERAHKIEIPRAFVCAESKIFDVSEWAICQGMAC
RPNTHRPSFHVNMVGLEKTTQRSNSSRFPWDLDVEMMDEDEEEFELWLQQALASGLFCETSKRRKSWSPFKLSQMKSKKQ
WRRTST*

DNA
ATGGAGGATATTGGGTTGGTTAAACAAGGTTGGAACTGGATGCAGTCTCAGAAACACATGTGTTCGAATGCTTGTTCTGC
GGTGCGGCGTTTTGGGGAGAAGATAGGGGAGCTTGTGGAGCGTCACTGGCCATTGGTGTGTAGTGGATGTGGGAAGCTGT
TAGGGCTGCTCCGCCTGGGAATTGTTTACTGGAAAGATTGTATTTTGAGGGGTTTCCGTTGCAGTGCTAAGTTGGGCTCA
GCTGCTTTGCTTTTGATCATGTGGAGTTGCTTCCTTAGCTTGACTTCCTTGTCTTGCTTGCTCTATGTTCTCCTCAGTAT
GGGAGCTGCTGCAGCTGTTGTTCTGAACTTGGGTTGCACTCCTGGGCTCTTTATTGTCGGACTGTTTGGTATTTTGATTT
TATGGATGTATGCAAACTTTTGGATCACCGGCACATTGTTCATAGTTGGAGGCTATTTATTCTCCTTAAACCACGCCCGT
CTGGTGGTTCTAATAGCGGCTGGATATGCAATGTACTGTGTAAAAGTCAGACTCGGATGGCTTGGTGTTCTGCTCTCAAT
GAACCTTGCCTTCTTGTCAAACGATGTGTTAAACTGTCTTCTTCAATGGTGTGACAATTTAAGCGAAAAGCCACAACCTG
AGGAACCAAAGAAGTCTGAAGAAACGATTATAGAAGAAGACTATCCAGGGGAATTTGAGTATCCATCAGTTCCTGTAGAA
GAAGAAGAAGAAGAGAAAACTGAGAAAAAGGTTCACGAGAATAAGTCATCTGCTGAACCAACTGCTCCTACTACAACTGT
TGTTAACACCGTGAGGGAGATTACTAGTGTTAAGATGGTTAAAGTGGATACAAGTTCATCAGCTGATGAAATGAAGAGGA
TACTAAAGAGTTTGAATCATTATGAAGCGTTGGGGTTTTCTAGGCATAAGAAGATAGATGATGCTGTGCTTAAGAAAGAG
TATAGAAAGAAGGCAATGTTGGTTCATCCTGATAAGAATATGGGAAGTCCTTTGGCGAGTGAATCATTCAAGAAACTTCA
ATGTGCTTACGAGGTTCTTTCTGATATTGTAAAGAAGAGAGATTACGATGAGCAATTAAGAAAAGAAGAGTCTAGGACCA
GGAGTGTTTGTCAGACATCTCATGCTTCTTCACATCAGAGTGGTGCTGGTTATAGAGCAGAAGAGTCGAGGAGGATACAT
TGCACAAAATGTGGTAATTCACATATATGGGTATGCACCAGTAGGACTAAAGCAAAGGCAAGATGGTGCCAGGATTGTGG
TCAATATCATCAAGCCAAAGATGGAGATGGCTGGGTCGAACTCAAAGGAACATTACCCTTTGAGAGAGCACATAAGATTG
AGATACCACGCGCTTTTGTTTGTGCGGAGAGCAAGATCTTTGACGTCTCAGAATGGGCCATATGTCAGGGAATGGCGTGT
AGACCAAACACGCATAGGCCAAGCTTTCATGTGAACATGGTTGGGTTAGAGAAGACTACACAAAGATCAAACTCGAGTAG
GTTCCCATGGGATCTAGACGTTGAGATGATGGATGAGGACGAAGAAGAGTTCGAGCTGTGGCTTCAACAAGCACTTGCTT
CTGGTCTGTTTTGCGAGACCTCAAAACGCAGGAAAAGCTGGAGCCCTTTCAAGTTAAGCCAGATGAAAAGCAAGAAACAG
TGGCGAAGGACATCCACTTGA