Details for Chinese cabbage Locus Brara.G03611

Position : A07 ( 5`- 26812402 .. 26814567 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03611

Protein [Map View]
MAKRKEGSKKMNIAIIHPDLGIGGAERLIVDAAVELASQGHKVHVFTSHHDKSRCFEETLSGIFQVTVYGSFLPRHIFYR
LHAVCAYLRCLFVALCVLLGWSSFDVVLADQVSVVVPLLKLKRSSKVVFYCHFPDLLLAKHTTALRRMYRKPIDFLEEQT
TGMADMILVNSNFTASTFAKTFKRLHGRGSRPAVLYPAVNVDQFIEPHAYKLNFLSINRFEKKKNIDLAVSAFAILCKHK
LTLSDDVTLTVAGGYDERLKENVEYLEELKSLAEKEGVSNRVNFITSCSTAERNELLSSCLCVLYTPTDEHFGIVPLEAM
AAYKPVIACNSGGPVETVKSGETGYLCEPTPEDFSSAMAKFVEDPELARRMGSEARKHVVESFSAKTFGEKLNQYLVDVV
SSPKED*

DNA
ATGGCGAAGAGAAAAGAAGGTTCGAAGAAGATGAACATCGCCATCATACATCCAGATCTTGGAATCGGTGGAGCAGAGAG
ATTGATCGTCGATGCGGCGGTTGAGCTTGCCTCGCAGGGTCATAAAGTTCACGTCTTCACCTCTCACCACGACAAATCTC
GATGCTTCGAGGAAACTCTCTCTGGAATCTTTCAAGTTACAGTGTATGGTTCTTTCCTGCCACGTCATATCTTCTACCGT
CTACACGCGGTTTGTGCGTACCTGAGGTGCTTGTTCGTTGCTCTTTGTGTTCTCTTGGGATGGTCTTCCTTCGACGTTGT
ACTAGCTGACCAGGTCTCAGTCGTTGTCCCGTTGCTGAAACTCAAAAGATCATCAAAGGTTGTGTTCTACTGCCACTTCC
CGGATCTCTTGTTAGCTAAACACACAACTGCACTTAGGAGGATGTATCGTAAACCCATTGACTTTCTCGAAGAACAAACC
ACAGGAATGGCTGATATGATCCTTGTTAACAGCAACTTCACTGCGTCAACGTTTGCAAAAACGTTTAAGCGTCTTCACGG
ACGAGGAAGCCGCCCTGCTGTTCTTTACCCTGCAGTCAATGTCGATCAGTTCATTGAACCACACGCTTATAAGTTGAATT
TTCTCTCTATAAACCGGTTTGAGAAGAAGAAGAACATCGATCTAGCTGTTTCAGCTTTTGCCATTCTATGCAAACATAAG
CTAACTCTGAGTGATGATGTTACCCTCACCGTTGCTGGTGGATATGACGAGAGACTGAAAGAGAATGTAGAGTACTTGGA
GGAGCTGAAAAGCTTAGCGGAGAAAGAAGGAGTTTCTAACCGAGTAAACTTCATCACATCTTGTTCAACAGCCGAAAGAA
ACGAGCTTCTCTCTTCCTGCTTGTGCGTCCTCTACACACCAACGGATGAGCATTTCGGTATAGTTCCGTTAGAAGCGATG
GCTGCGTACAAACCTGTGATAGCCTGCAACAGCGGTGGCCCCGTGGAGACGGTGAAGAGTGGAGAAACAGGGTATCTCTG
TGAACCGACTCCAGAAGATTTCAGTTCGGCGATGGCTAAGTTCGTCGAGGATCCTGAGTTGGCGAGGAGAATGGGAAGTG
AAGCGAGGAAGCATGTGGTTGAGTCATTCTCTGCGAAGACGTTTGGAGAGAAGTTGAATCAGTATCTAGTTGATGTAGTA
TCAAGTCCTAAAGAAGATTAA