Details for Chinese cabbage Locus Brara.G03602

Position : A07 ( 5`- 26786953 .. 26792400 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03602

Protein [Map View]
MWRFVWSLLLLFVMCKDTIVMAKSAAILLPSQTGVDDSVCSAPDPSLNYKPVIGILTHPGDGATGRLNNDTNASYIAASY
VKLAEAGGARVIPLIYNEPEELLFKKLELVNGVIFTGGWAKKGLYFDVVKKIFTRALERNDGGEHFPVYAICLGFELLTM
IISQNTDIFEKVDAKNAASSLQFVENVSTQGTVFQRFPPELLKKLTTDCLVMQNHQFGISPENFEGNSALSRFFKIVTTC
LDGNRKAYVSTVQSQTYPVTGFQWHPEKNAFEWGSSKIPHSEDAVHVTQLIANYLVGEARKSQNRPSPEKVLSNLIYNYK
PTYCGYEGRGYDEVYIFTQQRSLL*

DNA
ATGTGGAGATTCGTATGGTCACTGCTCCTACTCTTCGTCATGTGCAAAGATACCATCGTGATGGCGAAGTCTGCGGCGAT
TCTCCTTCCTAGTCAAACCGGAGTTGACGATTCTGTATGCTCCGCGCCGGATCCGAGCCTGAACTACAAGCCGGTTATAG
GTATTCTGACCCATCCCGGAGACGGCGCGACGGGTAGGTTGAACAACGATACGAACGCGTCGTACATCGCAGCGTCGTAT
GTGAAATTGGCTGAAGCTGGTGGAGCTCGTGTGATTCCTCTCATCTATAACGAACCCGAAGAGCTTCTCTTTAAGAAGCT
TGAATTGGTGAATGGTGTGATATTCACTGGTGGTTGGGCTAAAAAAGGATTGTATTTTGATGTGGTCAAAAAGATATTCA
CTAGAGCTTTGGAAAGAAATGATGGTGGAGAGCATTTTCCTGTGTATGCCATTTGTCTAGGATTCGAGCTGCTGACAATG
ATCATAAGCCAGAACACAGACATTTTTGAAAAAGTTGATGCCAAGAATGCTGCATCAAGTCTCCAGTTCGTTGAAAATGT
TAGCACCCAAGGAACCGTATTCCAAAGATTTCCCCCAGAGTTGTTGAAAAAACTCACTACAGACTGTTTGGTTATGCAAA
ACCATCAGTTTGGTATCTCGCCAGAAAACTTTGAAGGAAATAGTGCTCTGTCTCGTTTCTTTAAGATTGTCACAACATGC
CTTGATGGCAACCGCAAGGCTTATGTTTCAACCGTTCAATCGCAAACATACCCCGTAACCGGCTTCCAGTGGCATCCTGA
GAAAAATGCATTCGAGTGGGGATCATCCAAAATTCCACATTCCGAGGACGCGGTCCACGTGACTCAGCTCATTGCGAATT
ATCTAGTCGGTGAAGCTAGGAAGTCACAGAACCGACCATCTCCTGAGAAAGTGCTGAGCAATCTCATTTATAATTACAAG
CCTACGTACTGTGGATACGAAGGGAGAGGTTACGACGAGGTTTACATTTTCACACAACAACGATCCCTTCTCTGA