Details for Chinese cabbage Locus Brara.G03601

Position : A07 ( 5`- 26784153 .. 26786799 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03601

Protein [Map View]
MTHTETLNILDELESLVSDQLQVVSYKWLSRNFSISSKTAKSLLMEFVEKNGKGVEVVYIVSGWLKNTPSDHCTRLVSSS
KLAEVEKEFNGTHSVSIYSVQASIPMEPAAIWNSEFVQAEELFREPSAADNCLRDNRFCGISNSFVKRNIEGATANVTAP
GTESVRTTVPSIPKVKNETVTTAPAQKQPAKSSDDKEKPLPVPASKKNGQAQKSVTGTGGSLKNMWGRVPVKAEDESATI
EVKKQDNSEAQKPSHDVKSKGGSDDEAPDVSIRNRKRKVIFDFSDEECEDVISLASPSSPKINPGPDSEETKDSGPENPD
KRVSGETKTDEPEVREEEDCQKTASADTSGVRKEEKPMASAAGVNPSKGRVTNAPSSPKRKKVLKTRIDERGREVTEVVW
EDTETNAKKKEEDSDTSKKLNDGKSANAAVNRAVVQKKSPAMGAANAGGKTGSKKGGNVKDPKQGNIMSFFKKKV*

DNA
ATGACACACACCGAAACCCTAAACATCCTCGACGAACTCGAGTCTCTCGTCTCCGATCAGCTTCAAGTGGTATCTTACAA
ATGGCTGAGTCGAAATTTCTCTATTTCATCAAAAACTGCCAAGAGCTTGCTTATGGAATTCGTCGAGAAAAATGGGAAAG
GAGTTGAAGTTGTTTATATTGTGTCTGGGTGGCTAAAGAACACACCTTCTGATCATTGCACAAGGCTTGTATCTAGTTCC
AAACTTGCAGAGGTGGAGAAAGAGTTCAATGGAACTCATTCAGTTTCTATATACAGTGTTCAAGCTAGTATTCCGATGGA
GCCAGCAGCTATATGGAACAGTGAGTTTGTGCAAGCAGAAGAACTCTTCAGGGAGCCTTCTGCCGCTGATAATTGCTTGA
GAGACAACAGGTTTTGTGGCATCTCTAATTCTTTTGTTAAGCGTAATATAGAGGGAGCTACTGCAAATGTTACAGCCCCG
GGAACTGAAAGCGTGAGAACTACAGTGCCTTCAATCCCTAAGGTTAAAAATGAAACTGTTACTACTGCTCCAGCTCAAAA
ACAGCCTGCGAAATCCTCCGATGATAAAGAAAAGCCCCTTCCTGTGCCCGCTAGTAAAAAGAACGGTCAAGCCCAAAAGA
GCGTTACTGGAACAGGGGGTTCGTTGAAAAATATGTGGGGCCGTGTGCCTGTGAAAGCAGAAGATGAATCTGCAACAATA
GAGGTCAAAAAACAGGATAACTCAGAAGCTCAAAAGCCTTCTCACGATGTCAAGAGCAAGGGAGGCAGCGATGATGAGGC
CCCAGATGTCAGTATCAGGAACAGAAAAAGGAAGGTGATATTTGATTTTTCTGACGAAGAGTGTGAAGATGTTATCAGCT
TAGCATCTCCTAGCAGTCCTAAGATTAATCCGGGTCCAGATAGCGAAGAAACCAAAGATTCAGGTCCGGAAAATCCTGAT
AAACGTGTATCTGGAGAGACCAAAACAGATGAACCAGAGGTCAGAGAAGAAGAAGACTGTCAAAAAACTGCTTCTGCTGA
TACTTCCGGTGTCAGAAAAGAAGAGAAACCTATGGCTTCTGCAGCTGGAGTTAATCCCTCAAAGGGAAGAGTGACTAATG
CTCCTAGTTCACCGAAAAGGAAAAAAGTGTTGAAGACGCGGATTGATGAGCGTGGGAGAGAAGTAACTGAGGTAGTCTGG
GAGGATACAGAAACAAACGCAAAGAAGAAAGAAGAAGACAGTGATACAAGTAAGAAGTTAAATGATGGCAAAAGCGCAAA
CGCTGCTGTTAACAGGGCTGTTGTTCAGAAGAAGAGCCCGGCCATGGGAGCTGCAAACGCAGGAGGAAAAACAGGAAGCA
AGAAAGGAGGGAACGTGAAAGATCCAAAGCAAGGGAACATTATGTCTTTCTTCAAGAAGAAAGTCTAA