Details for Chinese cabbage Locus Brara.G03600

Position : A07 ( 5`- 26782405 .. 26783740 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03600

Protein [Map View]
MAVLCSSSTVILPSSVKPSGSNRRSPFLGFSLTAISKPSARVGIYANTKRGLQVKCEAEEQATATSLVPANQRWMFDEEE
ANGPDIWNTTWYPKASDHVNTDKPWYVVDATDKILGRLASTIANHIRGKNLASYTPSVDMGAFVIVVNAEKVAVSGKKRN
QKLYRRHSGRPGGMTVETFDQLQQRIPERIIEHAVRGMLPKGRLGRALFNHLKVYKGPDHPHEAQKPLDLPIRDKRIQLQ
K*

DNA
ATGGCGGTTCTCTGTTCGTCTTCAACGGTTATACTCCCTTCTTCGGTGAAACCCTCCGGAAGTAACAGAAGGTCTCCGTT
TCTAGGCTTCTCTCTAACTGCCATCTCGAAGCCGTCGGCACGAGTCGGCATTTACGCGAACACGAAGAGGGGATTGCAGG
TGAAGTGCGAAGCTGAGGAGCAGGCGACTGCTACTTCTCTTGTTCCGGCGAATCAACGGTGGATGTTCGACGAAGAGGAA
GCTAATGGCCCTGACATTTGGAACACGACATGGTACCCAAAGGCTTCAGACCATGTGAACACGGACAAGCCTTGGTACGT
TGTCGATGCAACTGACAAGATTCTCGGTAGATTGGCGTCAACCATTGCTAACCACATCCGTGGGAAGAACCTTGCCTCCT
ACACTCCCAGTGTCGACATGGGAGCCTTTGTGATTGTGGTGAATGCTGAGAAAGTAGCTGTGTCTGGAAAGAAGAGGAAC
CAGAAGCTGTACAGGAGGCATTCAGGGCGACCTGGCGGTATGACGGTTGAAACATTTGATCAGTTGCAGCAGAGGATTCC
AGAGAGAATCATTGAGCATGCTGTTCGTGGAATGCTTCCAAAGGGACGGCTTGGGAGAGCTCTGTTCAATCACCTGAAGG
TGTACAAAGGCCCAGACCATCCTCATGAGGCACAGAAGCCGCTTGATCTGCCCATCAGGGACAAGAGAATACAGCTGCAG
AAATAG