Details for Chinese cabbage Locus Brara.G03599

Position : A07 ( 5`- 26779837 .. 26782209 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03599

Protein [Map View]
MASISSTPLLNSTSLSPLRFPNFSSPSPFAGSCRFLNRNLGSSLSPTVNRSGGAIMAAASMQGVVTEAMNLIQTTSPTWK
SAVANNVLIFVLGSPLLVTGLSASGIAAAFLLGTLTWRAYGSAGFLLVAAYFVLGTAATKVKMSEKEAQGVAEKKKGRRG
PRSVIGSSAAGCVCAFLSIYQVGGSAFSQLFRLGFVSSFCTKVSDTVSSEIGKAFGKTTYLATTFKIVPRGTEGAMSVEG
TLAGLLASFFLASVGCFLGQITPPEAAVCVLASQIANLGESIIGASFQDKEGFKWLNNDVVNVINISLGSIVAILMQQFI
LQNWVK*

DNA
ATGGCGTCGATTTCGTCAACTCCACTCTTAAATTCTACATCCCTTTCACCTCTAAGATTCCCCAATTTCTCTTCTCCGTC
TCCGTTCGCCGGATCCTGCCGATTTTTAAACCGTAATTTGGGATCATCTCTATCGCCGACGGTGAACAGATCCGGCGGTG
CTATTATGGCTGCGGCATCGATGCAGGGAGTGGTGACTGAGGCGATGAACCTGATCCAAACGACGTCGCCTACTTGGAAG
TCCGCGGTGGCTAACAATGTGTTGATATTCGTTCTCGGGTCGCCGCTTCTCGTCACCGGATTGTCGGCTTCCGGGATCGC
CGCGGCGTTCTTGCTCGGGACTTTGACTTGGAGGGCTTATGGGTCTGCTGGGTTCCTCTTAGTCGCTGCTTATTTTGTTT
TGGGAACAGCGGCGACAAAGGTTAAGATGTCTGAGAAGGAAGCACAAGGTGTAGCCGAGAAGAAAAAAGGTAGAAGAGGA
CCACGCAGTGTGATTGGTTCAAGTGCTGCTGGTTGTGTCTGCGCTTTTCTTTCAATATATCAAGTGGGAGGATCAGCTTT
TTCTCAGCTTTTCCGCCTTGGTTTCGTTTCCAGTTTCTGCACTAAAGTCTCCGACACCGTCTCCAGCGAGATAGGGAAAG
CTTTTGGAAAAACTACGTATTTAGCCACAACATTTAAGATAGTACCAAGAGGAACCGAGGGAGCTATGAGTGTTGAAGGA
ACATTGGCTGGGCTTTTAGCATCATTTTTTCTTGCCTCTGTTGGCTGTTTCCTTGGTCAGATAACTCCTCCAGAAGCAGC
TGTTTGTGTACTAGCTTCCCAGATTGCCAATCTTGGAGAAAGCATAATAGGTGCATCTTTTCAAGACAAAGAAGGATTCA
AATGGCTAAACAATGATGTAGTGAACGTGATCAACATAAGCTTGGGAAGCATCGTGGCGATATTGATGCAGCAGTTTATA
CTCCAGAACTGGGTCAAGTAA