Details for Chinese cabbage Locus Brara.G03595

Position : A07 ( 5`- 26758084 .. 26764672 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03595

Protein [Map View]
MPGNKYNLSSSHIPLSRTERLLRERELREKRRSNRALNPNDNPDNSENDLRLEGDSSRQQYVEQYLEGAAAAMAHDDVCE
RQEVRPYNRQRLLVVANRLPVSAVRRGEDSWSLEISAGGLVSALLGVKEFEARWIGWAGVNVPDEVGQKALTKALAEKRC
IPVFLDEEIVHQYYNGYCNNILWPLFHYLGLPQEDRLATTRSFQSQFTAYKKANQMFADVVNEHYEEGDVVWCHDYHLMF
LPKCLKEYNSKMKVGWFLHTPFPSSEIHRTLPSRSELLRSVLAADLVGFHTYDYARHFVSACTRILGLEGTPEGVEDQGR
LTRVAAFPIGIDSERFIRALEVPDVIQHMKELKERFAGRKVMLGVDRLDMIKGIPQKILAFEKFLEENASWRDKVVLLQI
AVPTRTDVSEYQKLTSQVHEIVGRINGRFGTLTQVPIHHLDRSLDFYALCALYAVTDVALVTSLRDGMNLVSYEFVACQE
AKKGVLILSEFAGAAQSLGAGAILVNPWNITE

DNA
ATGCCTGGGAACAAGTACAACCTCAGTTCTTCTCACATCCCACTCTCTCGGACAGAACGGCTCTTGAGAGAAAGAGAGCT
TAGAGAGAAGAGGAGGAGCAACCGTGCTCTCAACCCTAATGACAATCCTGACAACTCTGAGAACGACCTGCGTTTAGAAG
GTGACAGTTCAAGGCAACAATATGTTGAGCAGTACCTGGAAGGTGCTGCTGCTGCTATGGCCCACGATGATGTGTGTGAG
AGGCAAGAAGTAAGGCCTTACAACAGGCAACGGCTCCTTGTGGTGGCTAACAGGCTCCCTGTTTCTGCTGTGAGAAGAGG
TGAAGATTCATGGTCTTTAGAGATCAGTGCTGGTGGTCTAGTTAGTGCTCTCCTAGGTGTGAAGGAGTTTGAGGCCAGAT
GGATTGGATGGGCTGGTGTTAATGTGCCTGATGAGGTTGGTCAGAAGGCACTTACCAAAGCTTTAGCTGAGAAGAGGTGT
ATACCTGTGTTCCTTGATGAAGAGATTGTGCATCAGTACTACAACGGTTACTGCAACAACATCCTATGGCCTCTGTTTCA
CTACCTTGGACTTCCACAAGAAGACCGTCTTGCCACAACGAGAAGCTTCCAGTCTCAGTTCACTGCCTACAAGAAAGCAA
ACCAAATGTTTGCTGATGTTGTCAACGAGCATTATGAAGAAGGAGATGTCGTCTGGTGCCATGATTACCATCTCATGTTC
CTTCCTAAATGTCTTAAAGAGTACAACAGTAAGATGAAAGTTGGATGGTTTCTCCACACACCGTTCCCTTCTTCTGAGAT
ACACAGGACGCTTCCTTCAAGATCTGAGCTGCTTAGATCAGTTCTTGCTGCTGATTTAGTAGGGTTTCATACGTATGACT
ATGCAAGACACTTTGTGAGTGCGTGCACTCGGATACTTGGGCTTGAAGGAACACCTGAGGGTGTTGAGGATCAAGGCAGG
CTCACTCGAGTTGCAGCTTTTCCAATAGGTATAGATTCTGAGAGGTTTATAAGAGCACTTGAAGTCCCTGACGTGATACA
ACACATGAAGGAGTTGAAAGAACGGTTTGCTGGCAGAAAGGTGATGTTAGGTGTTGATCGGCTTGATATGATCAAAGGGA
TTCCACAAAAGATTCTTGCGTTTGAAAAGTTTCTTGAGGAGAACGCAAGCTGGCGTGATAAAGTGGTGTTACTGCAAATT
GCAGTGCCAACAAGAACAGATGTCTCTGAATATCAAAAACTCACAAGCCAAGTTCATGAGATTGTTGGACGCATTAATGG
TCGTTTTGGGACACTGACTCAAGTTCCAATACATCACCTGGATCGTTCTCTGGACTTTTATGCTTTATGTGCACTTTATG
CCGTCACAGATGTTGCACTTGTCACATCTCTGAGAGATGGGATGAACCTTGTCAGTTACGAGTTTGTTGCTTGCCAAGAG
GCTAAAAAGGGCGTCCTCATTCTCAGTGAATTTGCAGGAGCTGCACAGTCTCTAGGTGCTGGAGCCATTCTTGTGAATCC
TTGGAACATTACAGAA