Details for Chinese cabbage Locus Brara.G03594

Position : A07 ( 5`- 26751300 .. 26755631 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03594

Protein [Map View]
MMIRALRETNHTEYCNTKPAKSSLGIFNAPRRSSRVKVIPIPSIVMVRPIMVKSGVTQLKALGFTSPSKHPRDTHTGNAV
DTASPRNSTHSPKLLFFSFSAGKSFDETPQRVKSSTLRRCLHVSGRAKRGLRVISRVEQQEMRRREGSGSSSSLSNESCL
WSLIVTKIPKFLREMASYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSKNSPSFKFVKGDI
ASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQVRRFIHVSTDEVYGETDEDALVG
NHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMSGKVLPIHGDGSNVRSYL
YCEDVAEAFEVILHKGEVGHVYNIGTKKERRVNDVARDVCKLFGMDPEASIKFVENRPFNDQRYFLDDEKLKKLGWSERT
TWEEGLKKTMEWYTQNPEWWGDVSGALLPHPRMLMMPGGRHFDGSDEISSAASASDKPSQTHMVVPSTRSSTSTPQKPSL
KFLIYGKTGWIGGLLGKLCEKQGIAYEYGKGRLEDRASLLQDVMSVKPTHVFNSAGVTGRPNVDWCESHKTETIRANVAG
TLTLADVCREHGLLMMNFATGCIFEYDEKHPEGSGIGFKEEDTPNFTGSFYSKTKAMVEELLKEYDNVCTLRVRMPISSD
LNNPRNFITKISRYNKVVNIPNSMTVLDELLPISIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYINPEFKWANFTLEE
QAKVIVAPRSNNEMDASKLK

DNA
ATGATGATTAGAGCATTGCGAGAGACAAACCATACCGAGTACTGCAACACAAAGCCGGCGAAGAGCTCTTTGGGCATCTT
CAACGCGCCGCGAAGATCATCGAGAGTCAAAGTCATCCCCATCCCAAGCATCGTGATGGTAAGACCTATAATGGTCAAAT
CAGGAGTGACCCAATTGAAAGCACTCGGCTTCACCAGCCCCAGCAAGCACCCAAGAGATACCCACACCGGAAACGCCGTC
GACACCGCCTCTCCCAGAAACTCGACCCACTCCCCAAAGCTCCTCTTTTTCTCTTTCTCAGCGGGGAAGTCGTTCGACGA
AACGCCGCAGCGAGTCAAAAGCTCAACGCTTCGCCGCTGCTTACACGTATCAGGAAGAGCCAAACGCGGTTTGAGAGTAA
TCTCGCGAGTTGAGCAGCAAGAGATGCGACGTAGAGAAGGCAGCGGATCTTCTTCTTCCCTCTCAAATGAGTCTTGTCTG
TGGTCTTTGATCGTCACAAAGATCCCAAAATTTCTCAGAGAGATGGCTTCGTACACGCCCAAGAACATTCTCATAACCGG
AGCCGCCGGTTTCATCGCCTCCCACGTGGCGAACAGGCTCATCCGAACCTACCCTCACTACAAGATCGTGGTCCTCGACA
AGCTCGACTACTGCTCCAACCTCAAGAACCTTAACCCTTCGAAAAACTCCCCCAGCTTCAAGTTCGTGAAAGGCGACATC
GCCAGCGCCGACCTCGTCAACCACCTCCTCATCACCGAAGGCATCGACACCATCATGCACTTCGCCGCTCAGACCCACGT
CGACAACTCCTTCGGCAACAGCTTCGAGTTCACCAAGAACAACATCTACGGTACCCACGTCCTCCTCGAGGCCTGTAAGG
TGACAGGCCAGGTGCGGAGGTTTATCCACGTGAGTACCGATGAGGTCTACGGGGAGACTGACGAGGACGCGCTCGTGGGT
AACCACGAGGCCTCTCAGCTTCTCCCCACGAACCCTTACTCTGCGACCAAGGCTGGCGCGGAGATGCTTGTGATGGCGTA
TGGGCGATCTTATGGTTTGCCAGTTATTACTACTCGTGGGAACAATGTTTATGGGCCGAATCAGTTTCCTGAGAAGCTGA
TTCCGAAGTTTATTTTGCTGGCGATGAGCGGGAAGGTTCTTCCGATTCACGGAGATGGGTCGAACGTGAGGAGTTATCTT
TACTGTGAGGACGTTGCTGAGGCGTTTGAGGTGATTCTCCACAAGGGTGAGGTTGGGCATGTTTATAACATTGGGACTAA
GAAGGAGAGGAGAGTGAACGATGTGGCTAGAGATGTTTGCAAGCTCTTTGGCATGGACCCTGAGGCGAGTATTAAGTTTG
TTGAGAACCGGCCTTTTAATGATCAGAGGTATTTTCTCGACGATGAGAAGCTGAAGAAGCTGGGGTGGTCGGAGAGGACG
ACGTGGGAGGAAGGGTTGAAGAAGACTATGGAGTGGTATACTCAGAACCCTGAGTGGTGGGGTGATGTCTCTGGAGCTTT
GCTTCCTCATCCGAGGATGCTGATGATGCCCGGTGGGCGACATTTCGATGGATCAGATGAGATTTCTTCAGCAGCTTCGG
CGTCTGACAAGCCGAGTCAAACTCATATGGTGGTTCCAAGCACAAGGAGCAGTACCAGCACGCCGCAGAAGCCTTCTCTT
AAGTTCTTGATATATGGTAAAACCGGATGGATCGGTGGTCTGCTTGGGAAGCTGTGTGAGAAGCAAGGGATTGCTTATGA
GTATGGGAAAGGGAGGTTGGAGGATAGAGCTTCTCTTTTGCAGGATGTTATGAGTGTTAAGCCGACTCATGTTTTCAACT
CGGCTGGTGTGACTGGGAGACCTAATGTTGACTGGTGTGAGTCTCACAAGACAGAGACTATCCGTGCTAATGTAGCTGGG
ACTTTGACTCTAGCTGATGTCTGCAGAGAGCATGGGCTTCTCATGATGAACTTCGCTACTGGTTGTATATTTGAGTATGA
TGAGAAGCATCCTGAAGGTTCGGGGATTGGGTTCAAGGAGGAAGACACTCCCAACTTCACTGGCTCCTTCTACTCAAAAA
CCAAAGCCATGGTCGAGGAGCTGCTAAAGGAGTATGACAACGTATGCACATTGAGGGTAAGGATGCCAATCTCGTCAGAT
CTAAACAACCCACGCAACTTCATCACCAAAATCTCAAGGTACAACAAAGTAGTCAACATCCCAAACAGCATGACAGTGTT
GGACGAGCTATTACCAATCTCCATCGAGATGGCCAAAAGAAACTTGAAAGGGATCTGGAACTTCACAAACCCGGGCGTGG
TGAGCCACAACGAGATCCTAGAGATGTACAGAGACTACATCAACCCTGAGTTCAAATGGGCAAACTTCACATTAGAGGAG
CAAGCTAAAGTCATTGTGGCTCCAAGAAGTAACAACGAGATGGATGCTTCTAAGCTCAAG