Details for Chinese cabbage Locus Brara.G03590

Position : A07 ( 5`- 26741172 .. 26743796 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03590

Protein [Map View]
MMMTSCRNIDLGTSVLDLISCGCGRRQFLLGNFPKAVCTARSYGGRNLVFLRRDVGRSCKAVPTKPKEISLVNGIGEAKT
VSFDLRQETSSKQPISLANLFEVVADDLQTLNDNLLSIVGAENPVLISAAEQIFGAGGKRMRPGLVFLVSRATAELAGLK
ELTTEHRRLGEIIEMIHTASLIHDDVLDESDMRRGKETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIK
DFASGEIKQASSLFDCDVTLEDYLLKSYYKTASLVAASTKGAAIFSRVDTDVTEQMYEFGKNLGLSFQVVDDILDFTQSS
EQLGKPAGSDLAKGNLTAPVIFALEKEPRLREIIESEFCEEGSLEEGIELVREGGGIRRAQELAREKADEALKNLQCLPQ
SGFRSALEEMVMFNLERID*

DNA
ATGATGATGACATCTTGTCGGAATATTGACTTGGGTACTAGTGTTCTTGATCTGATCTCGTGTGGCTGTGGTCGTCGTCA
GTTTCTATTAGGCAACTTTCCCAAGGCTGTTTGTACGGCGAGAAGCTACGGCGGTCGGAATCTGGTGTTTCTCCGGCGTG
ACGTGGGGAGGAGCTGCAAAGCTGTTCCGACAAAACCCAAAGAGATCTCTTTGGTCAACGGAATAGGTGAAGCCAAAACG
GTGAGTTTTGATTTGAGGCAAGAGACCTCCTCAAAGCAGCCCATTTCGTTGGCGAATCTGTTTGAGGTTGTAGCTGATGA
TCTTCAGACGTTGAATGATAATCTTTTATCGATTGTTGGTGCAGAGAATCCGGTTTTGATATCTGCAGCTGAGCAAATCT
TCGGAGCTGGTGGTAAAAGGATGAGACCCGGTTTAGTGTTCCTTGTTTCACGAGCCACTGCAGAGCTAGCTGGCCTAAAG
GAACTTACAACGGAACATAGGCGTTTAGGTGAGATCATTGAGATGATTCACACTGCAAGCTTGATACATGATGATGTGTT
AGATGAGAGTGATATGCGCAGAGGTAAGGAAACAGTTCACGAGCTTTTTGGCACGAGAGTAGCTGTACTAGCTGGTGATT
TCATGTTTGCTCAAGCATCATGGTACTTAGCCAACCTCGAGAACCTGGAAGTTATCAAGCTCATAAGTCAGGTGATCAAA
GACTTTGCGAGCGGAGAGATAAAGCAAGCCTCGAGTCTGTTCGACTGTGACGTTACTCTAGAAGACTACTTGCTCAAGAG
TTACTACAAGACAGCCTCGCTGGTGGCCGCAAGCACCAAAGGAGCTGCTATCTTCAGCAGAGTCGATACCGATGTGACAG
AGCAGATGTACGAGTTCGGGAAGAATCTCGGCCTCTCTTTCCAAGTGGTCGACGACATTTTGGACTTCACTCAGTCGTCA
GAGCAGCTAGGGAAGCCAGCAGGGAGTGATCTGGCTAAAGGTAACTTAACCGCGCCTGTGATTTTCGCGCTGGAGAAGGA
GCCGAGGCTGAGAGAGATCATAGAGTCTGAGTTCTGCGAGGAGGGTTCTCTGGAAGAAGGGATTGAGTTGGTGAGAGAAG
GCGGTGGAATCAGAAGAGCGCAAGAGTTGGCTAGGGAGAAAGCTGATGAAGCTTTGAAGAATCTGCAGTGTTTGCCTCAG
AGTGGCTTCAGGTCGGCTCTAGAAGAAATGGTGATGTTTAATCTTGAAAGAATCGATTAG