Details for Chinese cabbage Locus Brara.G03587

Position : A07 ( 5`- 26723822 .. 26724848 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03587

Protein [Map View]
MEAALRIFTLSFLLSLLSANPDVIDSLGKFPPSCNRIECPSYELVNSGNGYEIRRYNTTVWISTEPIKDASLVKATRTSF
SQLFGYIQGNNDYHQKIEMTAPVIAQVSPSNGPLCESSFTVSFYVPKQNQPDPAPAKNLHVQRWDTRYVAVKQFGGYVSD
DSVGEEAAELEESLKGTVWGKAIAKSREAGGLGSTSAYTVAQYNSPFEFLGRVNEIWLPFQMDK*

DNA
ATGGAAGCAGCTCTGAGAATCTTCACGCTATCGTTCCTTCTCAGTCTCCTCTCCGCTAATCCTGACGTCATCGATTCTCT
TGGGAAGTTTCCACCGTCGTGTAACCGAATCGAGTGTCCGAGCTACGAGTTGGTCAACTCCGGTAACGGCTACGAGATTC
GCCGTTACAATACTACCGTCTGGATTTCAACAGAACCCATTAAAGATGCCTCTCTCGTCAAAGCTACACGAACCAGTTTT
AGCCAATTGTTCGGTTACATTCAAGGGAATAACGACTATCACCAGAAGATAGAGATGACGGCTCCGGTTATCGCTCAAGT
CTCTCCGAGCAACGGTCCTTTATGTGAATCCTCCTTCACTGTATCATTCTACGTTCCTAAACAAAACCAACCTGATCCAG
CTCCGGCCAAGAACCTACATGTACAGAGATGGGACACGAGGTATGTTGCCGTGAAGCAATTCGGGGGATACGTGTCGGAT
GACAGTGTCGGAGAAGAAGCGGCGGAGCTGGAGGAGAGCCTAAAAGGTACCGTATGGGGCAAGGCAATTGCTAAAAGCCG
AGAAGCAGGCGGCCTTGGATCGACTTCTGCTTACACTGTAGCGCAGTACAACTCACCGTTCGAGTTCTTGGGTCGGGTCA
ATGAGATTTGGTTGCCTTTTCAGATGGACAAATGA