Details for Chinese cabbage Locus Brara.G03583

Position : A07 ( 5`- 26681753 .. 26684737 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03583

Protein [Map View]
MGNKLVGRKRQVVEERYTKPQGLYVNTDVDIKKLRKLIVESKLAPCYPGDDESCHELEECPICFLYYPSLNRSRCCMKSI
CTECFLQMKNPNSARPTQCPFCKTPNYAVEYRGVKTKEEKGMEQVEEQRVIEAKIRMRQKEMEDDEEKMQKRMESSCSSS
TSAVTGEMEYGSAASAISYNDPMEDAETSSSQNVSVARQRSRRPRGNRDDEVEADLEELMVMEAIWLSMQETGTQRDSGG
GEVTPFRQYVSEEDHSYAEPATPSSSSGGLPCAISALAEQRQQMVGESSNHNHNHNVNVSSYSMLPGNCDSYYDIEQETD
DIDHHHHHHHQQQHNYYHGNTEMGETGSSSSYMNGSESFHNFPLPPPPPLVIAPESFEEQMMMAMAVSLAEVHATTTTSA
PTEVTWQ*

DNA
ATGGGTAATAAGCTGGTGGGGAGGAAGAGGCAAGTGGTGGAAGAAAGATACACAAAGCCACAAGGCTTGTATGTGAACAC
AGATGTCGACATTAAGAAGCTTAGGAAACTCATTGTTGAGTCTAAGCTTGCTCCTTGCTATCCTGGAGACGACGAGAGTT
GCCACGAGCTCGAAGAATGCCCCATCTGCTTTCTGTACTATCCTAGCCTCAATAGATCAAGATGTTGCATGAAAAGCATT
TGTACAGAGTGTTTTTTGCAAATGAAGAATCCTAACTCAGCTCGGCCTACTCAGTGCCCTTTTTGTAAAACACCAAACTA
TGCTGTTGAGTACCGTGGAGTAAAGACCAAGGAGGAGAAGGGCATGGAACAAGTTGAAGAGCAAAGGGTAATAGAAGCGA
AAATAAGGATGAGGCAGAAAGAAATGGAGGATGATGAAGAGAAAATGCAGAAACGTATGGAATCATCCTGTTCCTCTAGC
ACAAGCGCAGTGACTGGTGAAATGGAATACGGTTCTGCTGCTTCAGCAATATCTTATAATGATCCCATGGAAGACGCTGA
AACTTCTTCATCACAGAACGTCTCAGTTGCTAGACAGCGCTCCCGCCGCCCTCGAGGAAACAGGGATGATGAGGTTGAGG
CTGATCTTGAAGAGTTAATGGTCATGGAGGCAATATGGCTCTCCATGCAGGAAACAGGGACGCAGAGAGATTCAGGTGGT
GGAGAAGTGACACCTTTTAGGCAGTATGTATCAGAAGAAGATCATAGTTATGCAGAACCAGCAACGCCGTCTTCATCATC
TGGTGGACTTCCTTGTGCAATCTCTGCACTTGCTGAACAACGCCAGCAAATGGTTGGTGAATCCTCCAATCACAATCACA
ATCACAACGTCAACGTTTCTTCGTACAGTATGCTTCCTGGCAACTGCGACAGTTACTACGACATAGAACAAGAGACAGAT
GACATTGACCACCACCATCATCATCATCATCAGCAGCAGCATAATTATTACCATGGCAACACCGAGATGGGAGAAACGGG
GAGCAGCTCTTCTTACATGAACGGCAGCGAGAGCTTCCACAATTTTCCTCTTCCACCACCTCCTCCTCTGGTGATTGCTC
CAGAGAGTTTTGAGGAGCAGATGATGATGGCTATGGCTGTGTCTTTGGCGGAGGTTCATGCCACGACCACCACAAGTGCA
CCAACTGAAGTTACTTGGCAATAA