Details for Chinese cabbage Locus Brara.G03582

Position : A07 ( 5`- 26678701 .. 26679199 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03582

Protein [Map View]
MSERGKTKSEPMKVVFINTQYVETDARSFKNVVQELTGKDAIVAAGPFESPSTSDDRCYGGGNRVGEDSRRPYDGGGAET
TTEFNRFFKEMPPMEELYKLWSES*

DNA
ATGTCTGAAAGAGGAAAGACGAAGTCGGAGCCAATGAAAGTTGTGTTCATTAACACACAGTACGTTGAGACCGATGCTCG
TAGCTTCAAAAATGTTGTTCAAGAACTCACAGGTAAAGATGCCATAGTCGCCGCCGGTCCTTTCGAGTCTCCATCCACTT
CCGACGACCGTTGTTACGGTGGAGGTAACAGAGTCGGTGAAGATTCGAGACGACCCTACGACGGCGGAGGAGCGGAGACG
ACGACGGAGTTTAATAGGTTTTTCAAGGAGATGCCTCCCATGGAGGAATTGTATAAGCTATGGTCTGAAAGTTGA