Details for Chinese cabbage Locus Brara.G03576

Position : A07 ( 5`- 26653636 .. 26654666 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03576

Protein [Map View]
MMMDKSCNSSGDSASVTSSTGNNHHLRQLNKLSHKISKPTSTSSSSISAAVNQETDHQFPPPQQQPQHQINHGNLHQHQP
PVYNINKNDFRDVNSMFAMDSNRREFSGLSPLAPLVSPRWYQQQQENAPPPLNSGRPPPPGTVSQAPPQSLGCLSSPKSP
YGLLSPSLLLSPTSGQLGFPASPTTVPPLPSPK*

DNA
ATGATGATGGACAAGAGCTGTAACTCCTCCGGCGACTCAGCCTCCGTGACGAGTAGTACCGGCAACAATCATCACCTAAG
GCAACTCAACAAGCTTTCTCATAAGATATCAAAACCAACATCAACCTCCTCCTCTTCCATCTCCGCCGCCGTGAATCAAG
AAACTGATCACCAATTTCCTCCTCCGCAACAGCAACCGCAGCATCAGATTAATCACGGCAATCTCCACCAGCACCAGCCA
CCTGTATACAACATCAACAAAAACGACTTCAGAGACGTGAACTCGATGTTCGCGATGGATTCGAATCGGAGGGAGTTCTC
TGGCTTGTCGCCTTTAGCTCCGTTGGTGTCGCCTCGATGGTATCAGCAGCAGCAGGAAAACGCTCCGCCGCCGCTAAACA
GCGGTCGTCCTCCTCCTCCGGGAACAGTCTCGCAAGCTCCGCCGCAATCGTTGGGGTGTTTAAGTTCGCCTAAATCGCCG
TACGGATTGCTATCGCCGAGCTTGCTTTTATCGCCGACGTCAGGTCAGTTAGGGTTTCCGGCATCGCCGACGACGGTACC
GCCGCTTCCTAGCCCTAAATAG