Details for Chinese cabbage Locus Brara.G03574

Position : A07 ( 5`- 26643486 .. 26648520 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03574

Protein [Map View]
MDETAAFRQRDRRPEALGSLSVLPDETICVLLEYLAPRDIAHLACVSSVMYILCNEEPLWMSLCLRRAKGPLDYKGSWKN
TTLHLEGVTQDNDRKPLHFDGFNSLYLYKRFYRCNASLDGFSFDDGNVERRRDISLDEFTKEYDAKKPVLLSGLADSWPA
SKTWTIDQLSEKYGEVPFRISQRSPNKISMKFKDYISYMKTQRDEDPLYVFDDRFGEAAPELLKDYSVPYLFQEDWFEIL
DKENRPPYRWLIVGPERSGASWHVDPALTSAWNTLLCGRKRWALYPPGKVPLGVTVHVNEDDGDVSIDTPSSLQWWLDYY
PLLADEDKPIECTLLAGETIYVPSGWWHCILNLEPTVAVTQNFVNKENFGFVCLDMAPGYQHKGVCRAGLLAVDDENSEE
MEEEETHGEDDSTLSYSDLTRKEKRVRMNGEEETENHEEDANGVSKRYNMWKNGFSYDIDFLSKFLDKERDHYNFPWSMG
NSVGQREMRGWLSKLWVLKPELRNLIWKGACIALNAEKWLRCLEEVCTFHNLPSVTEDEKLPVGTGSNPVYLFSDYAVKL
FVEGGLEQSMYGLGTELEFYDILGRANSSLKSHIPEVIASGILYFENGSYKVVPWDGKRIPDILTSSSLNFDASMLNSEF
PFGIWNKTLLQQRNKGKPPAPDSFGSLSSHVWPYIITQRCKGKIFAQLRDDLTWSDAQNLATFLGQQLRNLHQLPYPPVT
RPELLNANEGHEELKIPPEWKVFVDDLCHKKKDVTNRLENWGNPIPKALMNKIDEYIPDEFFVDLLHVFKDTDAGDETKP
CTWIHSDVMDDNIHMEPYADDDSVDGQHSSWRPGHILDFSDLSIGDPIFDLIPIHLDVFRGDTDLFKKLLESYGLPLIRS
KSAAADSMRKKVLSPSYRTMCYCILHEDNVLGAMFSIWDELRTAESWEQVELTAWSFLNSY*

DNA
ATGGACGAAACGGCGGCGTTTCGACAGAGAGATCGGCGACCGGAGGCGCTCGGCAGCCTCAGCGTGCTCCCAGACGAGAC
GATATGCGTTCTCCTCGAGTACCTTGCTCCTCGAGACATCGCTCACCTCGCTTGCGTCAGCAGTGTTATGTACATTTTGT
GCAACGAAGAGCCTCTGTGGATGAGCTTGTGCCTTAGGAGAGCAAAAGGTCCTCTTGACTATAAAGGCTCCTGGAAAAAT
ACCACATTGCATCTAGAAGGAGTTACTCAAGATAATGATAGGAAGCCTTTGCATTTTGATGGATTCAATTCGTTGTACTT
GTATAAACGATTCTATAGGTGTAATGCATCTCTTGACGGCTTCTCTTTTGATGATGGGAATGTTGAACGTAGGAGAGACA
TCTCCTTGGATGAGTTCACCAAGGAATACGACGCTAAGAAACCTGTTTTGCTCTCTGGCCTTGCTGATTCTTGGCCAGCC
AGTAAGACATGGACAATCGACCAGTTGTCAGAGAAATATGGTGAAGTCCCATTTAGAATCTCTCAGAGGAGTCCCAACAA
GATTTCTATGAAGTTCAAGGACTACATCTCGTATATGAAAACCCAGAGGGATGAAGATCCTCTTTATGTTTTCGATGACA
GGTTTGGAGAAGCTGCTCCCGAGTTATTGAAAGACTATAGCGTGCCTTATTTGTTTCAAGAAGATTGGTTTGAGATCTTG
GATAAAGAGAACCGTCCGCCATACAGATGGCTTATAGTTGGTCCGGAGAGGTCTGGTGCATCTTGGCATGTCGATCCAGC
TCTTACCAGCGCCTGGAACACCCTGCTTTGCGGTCGGAAAAGGTGGGCGTTGTATCCCCCTGGAAAAGTGCCTCTAGGTG
TTACAGTCCATGTAAATGAAGATGATGGTGACGTCAGCATCGACACCCCCTCATCTCTGCAGTGGTGGTTAGACTATTAT
CCACTCCTAGCCGACGAAGACAAACCGATTGAGTGCACACTACTAGCTGGCGAAACGATTTATGTTCCAAGTGGTTGGTG
GCACTGCATCCTCAATCTTGAACCAACAGTGGCTGTCACCCAGAATTTTGTGAACAAAGAAAACTTTGGGTTCGTGTGTT
TGGACATGGCGCCTGGGTATCAGCACAAAGGGGTGTGTCGTGCTGGGCTTCTTGCTGTTGATGATGAAAATTCCGAAGAG
ATGGAGGAAGAAGAAACACACGGTGAGGACGACAGTACTTTGAGCTATTCTGATCTCACCAGGAAAGAGAAGAGGGTACG
GATGAACGGAGAGGAAGAGACTGAGAACCACGAAGAGGATGCCAATGGAGTCTCAAAGAGATACAATATGTGGAAGAATG
GATTCTCTTATGATATCGATTTCTTGTCGAAGTTTCTTGATAAAGAAAGAGACCATTACAACTTCCCGTGGTCTATGGGA
AACTCTGTAGGTCAACGAGAAATGAGAGGCTGGCTATCTAAGCTTTGGGTTCTCAAGCCGGAGTTGAGGAATCTTATATG
GAAGGGAGCATGCATTGCTTTAAACGCTGAGAAATGGTTGCGATGTCTAGAGGAAGTATGCACCTTCCACAACTTGCCGT
CTGTTACGGAAGATGAAAAGCTTCCAGTCGGAACTGGCAGCAATCCTGTTTATCTGTTTTCCGACTATGCGGTAAAACTC
TTTGTGGAAGGAGGGCTGGAACAGTCTATGTATGGTCTTGGCACTGAGCTTGAGTTTTATGACATTCTTGGCCGGGCTAA
TTCTTCTTTGAAAAGCCATATCCCTGAGGTTATAGCAAGCGGGATTCTCTACTTCGAAAACGGATCTTACAAAGTTGTCC
CTTGGGATGGGAAGAGAATCCCAGACATTCTCACTAGCTCCAGTCTCAATTTCGATGCATCAATGTTGAACAGCGAATTC
CCATTTGGTATTTGGAACAAAACGCTACTTCAACAAAGAAACAAGGGGAAGCCACCAGCACCCGATTCTTTTGGTTCATT
GAGTTCACATGTTTGGCCGTATATTATAACACAGAGATGCAAAGGGAAGATATTTGCCCAATTAAGAGATGACCTGACGT
GGAGCGACGCTCAGAACCTGGCTACCTTTCTGGGACAACAGCTACGAAACCTTCATCAACTGCCATATCCGCCAGTCACA
CGTCCTGAGTTATTGAATGCAAATGAAGGTCATGAAGAGTTGAAGATTCCACCAGAATGGAAAGTCTTCGTTGATGATCT
GTGCCATAAGAAGAAGGACGTCACTAATCGTCTGGAAAACTGGGGAAATCCTATTCCTAAGGCTCTGATGAACAAAATAG
ACGAATACATTCCTGATGAGTTCTTTGTAGACTTGCTTCATGTTTTCAAGGACACAGATGCTGGAGATGAAACCAAGCCA
TGCACCTGGATACACTCGGACGTCATGGACGACAACATCCACATGGAACCATACGCAGATGATGATTCAGTAGATGGTCA
ACACAGTTCATGGCGTCCCGGTCATATTCTTGACTTCAGCGATTTATCCATAGGGGATCCCATCTTCGACTTGATACCAA
TACACTTGGACGTGTTTAGAGGGGACACTGATCTTTTCAAGAAGCTTCTAGAAAGCTACGGCCTTCCTTTAATCAGAAGT
AAGTCGGCAGCAGCAGACAGTATGAGGAAGAAAGTGCTGTCTCCTTCCTACCGCACAATGTGTTATTGTATATTACATGA
AGATAATGTGTTGGGTGCAATGTTCAGTATCTGGGACGAACTTCGAACAGCTGAATCATGGGAACAAGTTGAGCTCACTG
CTTGGAGTTTTCTTAACTCGTACTGA