Details for Chinese cabbage Locus Brara.G03571

Position : A07 ( 5`- 26623760 .. 26627439 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03571

Protein [Map View]
MPMPLQRGTSGGGARVSDVLRDNSQMKDKTGDNTSTLRFPFAFFFTDKAADPYTSRNNKQRLMLLFVKTTLALIVILALA
GSFWWTISISTSSSSGHVYQRSHSYRRLQEQLVSDLLDIGDISVGPTRWKELEYCSVDSESYVPCFNVSESLDRFCGSRE
GCLVLPPVDYKVPLRWPTGKDVIWFRNVKITADEVLTSGSINKRMMMLDDDQVSFRSASPMFDEIEDYSHQIAQMIGIKN
DNFIEAGVRTILDIGCGYGSFGAHLLSKNLLTMCIANYEASGSQVQLTLERGLPAMIASFVSKQLPYPSISFDMLHCSSC
GIDWDQKEGLFLVEIDRVLKPGGYFVWTSPLTNARSKEDVKRWSFVHDFAESICWTLLSQQDKTVVWKKTTKTKCYSSRK
PGVGPSVCNKGHEAESPYYKPLQMCLGGTRSKRWIPIEGRTRWPSRSHMNKTELSLYGLHPEEVGEDAENWKATVKEYWS
LLSPLIFSDHPKRPGDEDPSPPYNMLRNVLDMNAQFGGLNSALLEAKKTVWVMNVVPTAGPNHLPMILDRGFVGVLHDWC
EAFPSYPRTYDLVHADNLLSLQTSQHRSSCSLLNIFTEIDRLLRPEGWVIIRDTAQLVETARASTTQLKWEARVIEVESS
SEQRLLICQKPFTKRQSI*

DNA
ATGCCAATGCCACTGCAACGTGGCACCTCAGGAGGAGGAGCACGAGTTTCCGACGTTCTCAGAGACAACTCTCAGATGAA
AGACAAAACAGGAGACAACACCTCCACCTTGAGGTTTCCTTTCGCTTTCTTCTTTACCGACAAGGCTGCTGATCCTTACA
CGTCAAGGAACAACAAGCAGAGGTTGATGCTTCTGTTTGTTAAAACCACTTTGGCTCTTATTGTCATTCTTGCTCTCGCT
GGCTCCTTCTGGTGGACCATCTCTATCTCCACGAGCTCTTCTAGTGGTCATGTGTATCAACGCAGCCACAGCTACAGGAG
GTTACAGGAGCAGCTTGTTTCAGACTTGTTGGATATTGGAGACATCTCTGTAGGTCCCACTAGGTGGAAAGAGCTGGAGT
ATTGTAGTGTAGACTCTGAGAGCTATGTTCCTTGCTTTAATGTCTCTGAGAGTCTCGATCGGTTTTGTGGGTCGAGAGAG
GGCTGTTTGGTTTTGCCACCTGTGGATTATAAGGTTCCACTGAGGTGGCCAACGGGTAAAGATGTGATATGGTTTCGTAA
TGTGAAGATCACTGCTGATGAAGTGTTGACTTCTGGTAGTATAAACAAGAGGATGATGATGTTGGATGATGATCAAGTAT
CTTTCCGTTCTGCGTCTCCTATGTTTGATGAGATTGAAGACTATTCCCATCAGATTGCTCAGATGATTGGGATTAAGAAT
GATAACTTCATTGAAGCTGGTGTGAGAACTATATTGGATATTGGATGTGGTTACGGTAGCTTTGGAGCACATCTACTCTC
AAAAAACCTCTTAACAATGTGCATAGCGAACTACGAAGCCTCAGGTAGCCAAGTTCAGCTAACACTAGAGAGAGGTCTCC
CTGCAATGATTGCTTCCTTTGTATCAAAGCAGTTGCCGTATCCTTCTATTTCCTTTGATATGTTGCATTGCTCAAGCTGC
GGCATTGATTGGGACCAGAAAGAGGGGCTTTTTCTTGTGGAAATTGATAGAGTTTTGAAGCCAGGAGGTTACTTTGTTTG
GACATCTCCTCTCACAAACGCTCGTAGCAAAGAGGATGTTAAGAGATGGAGCTTTGTTCATGATTTTGCTGAAAGCATCT
GTTGGACTCTTTTGTCTCAGCAAGACAAGACAGTTGTCTGGAAAAAGACAACCAAAACAAAATGTTACAGTTCTCGGAAG
CCTGGGGTGGGTCCTTCTGTGTGTAACAAAGGGCACGAGGCTGAGTCTCCTTATTACAAGCCGCTTCAGATGTGTCTTGG
TGGAACAAGGAGCAAGAGGTGGATCCCCATTGAAGGCAGAACAAGATGGCCTAGCCGGTCTCACATGAATAAGACTGAGC
TTTCACTATATGGTCTTCACCCGGAGGAGGTTGGAGAAGACGCTGAGAACTGGAAAGCAACAGTCAAAGAATACTGGTCT
CTCTTGTCTCCTCTCATATTCTCTGATCACCCCAAGAGACCTGGAGATGAAGATCCATCACCTCCTTACAACATGCTTAG
AAACGTTTTGGACATGAATGCTCAGTTCGGTGGTCTCAACTCCGCGTTGCTGGAAGCAAAGAAAACGGTCTGGGTCATGA
ACGTTGTCCCTACAGCTGGACCTAACCACCTCCCAATGATCCTTGACCGTGGCTTTGTCGGCGTCTTACACGACTGGTGT
GAAGCGTTCCCTAGTTATCCAAGAACATATGATCTTGTCCACGCAGACAATCTTTTGTCTCTCCAGACAAGTCAGCACCG
GAGCTCATGCTCGCTTCTGAACATATTCACAGAGATTGATAGATTACTTCGTCCAGAGGGATGGGTGATAATCCGTGACA
CGGCACAGCTGGTGGAAACGGCTAGAGCTTCGACAACGCAGTTGAAGTGGGAGGCTAGAGTCATAGAGGTTGAAAGCAGC
AGTGAACAGAGACTCCTCATCTGCCAAAAGCCTTTCACCAAGAGACAATCAATCTAA