Details for Chinese cabbage Locus Brara.G03570

Position : A07 ( 5`- 26619899 .. 26623247 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03570

Protein [Map View]
MFNCFAGLIGKKKNKRNPKPTLPPRTQRILQIRREEPVKPLEKDEPNTNVIHHKFIDHKDNSATEQDSYDGEDERDENDS
THRESPPKFQVQEQAVASPTSKELGKEVTDCSENEHDNEESGHVSDPGLGRATSWVASPKLKRSCSTLSKFNGADPRAFH
DQRDSFETKSVRSHRSADGVMLKKHSSMQILPSGSRRLWWKLFLWSHRNLHKHLVSLKSSGNNHQSGYTSDFAEQSQTSH
QDSADNHQCHKNQWVAFSAESSSMKRVDEWVRGLDVDTVIPVNEEEDKPSFMASSKMVRSPSGNVNDSEAIVHANSLIQS
LSKSSSMAHISSIGLKAVPSISHFSSLKSIDLSNNFIVQITPASLPKGLHALNLSKNKISVIEGLRELTRLRVLDLSYNR
ISRIGQGLSNCTLIKELYLAGNKISNVEGLHRLLKLIVLDLSFNKIATTKAIGQLVANYNSLVALNILGNPIQSNVGEDV
LRKTVSSLLPKLVYLNKQLIKPQRAREVLKDSVAKAAFGGGDSLHHRRKRTSAKRVVGSPSPSSHHQKGKGRGSKGRSQH
QLKKTSYAETPSH*

DNA
ATGTTCAACTGCTTTGCTGGATTGATCGGTAAAAAGAAAAACAAGAGGAATCCAAAACCTACTCTGCCACCAAGAACACA
AAGAATCCTTCAGATCAGACGTGAAGAGCCAGTGAAGCCTCTAGAGAAGGATGAGCCTAACACCAACGTGATCCACCACA
AGTTCATTGATCATAAGGACAACAGCGCTACCGAGCAAGACTCATATGATGGTGAAGATGAACGCGATGAGAACGACTCA
ACTCACCGTGAGTCACCTCCTAAATTCCAAGTTCAAGAACAAGCGGTTGCGTCTCCGACAAGTAAGGAGCTAGGTAAGGA
AGTGACAGACTGTTCTGAAAATGAACATGATAATGAAGAAAGCGGCCACGTCAGCGATCCTGGCTTAGGTAGAGCCACGT
CTTGGGTGGCTTCACCTAAGCTCAAACGATCGTGCTCAACTCTCAGCAAGTTCAACGGTGCTGATCCTCGTGCTTTCCAT
GACCAGAGAGATAGCTTCGAGACCAAGTCAGTTAGGTCACATAGAAGTGCAGATGGAGTGATGCTCAAGAAACATTCATC
AATGCAGATACTCCCCTCAGGGAGCAGGAGGCTATGGTGGAAACTGTTCCTCTGGAGTCATAGGAACCTTCACAAACACC
TTGTCTCCCTAAAGTCTTCAGGCAACAATCACCAGTCTGGTTACACCTCTGACTTTGCTGAGCAAAGCCAAACTAGCCAT
CAAGATTCTGCAGACAACCACCAATGTCATAAGAATCAGTGGGTAGCGTTCTCTGCGGAGTCCTCTTCGATGAAACGAGT
GGATGAGTGGGTAAGAGGACTAGATGTAGACACAGTGATTCCAGTAAACGAGGAAGAGGACAAGCCCAGCTTCATGGCTT
CTTCTAAGATGGTGAGATCACCCTCAGGAAATGTAAATGACTCAGAGGCCATAGTGCATGCAAACAGCTTAATCCAGTCC
CTGAGCAAATCCTCAAGCATGGCTCACATCTCGAGCATAGGCTTGAAAGCTGTCCCAAGCATCTCACATTTCAGCAGCCT
CAAGTCCATTGATTTATCCAACAACTTCATAGTTCAAATTACTCCTGCATCGCTTCCAAAGGGCCTTCATGCGTTGAACC
TATCCAAGAACAAGATCAGTGTAATCGAAGGACTGAGAGAACTGACACGCTTAAGAGTGCTTGATCTCAGTTACAATCGT
ATTTCTCGCATTGGACAAGGTTTATCAAACTGTACACTGATCAAAGAACTATACCTAGCTGGGAACAAGATCAGCAACGT
AGAAGGCTTACACAGACTGCTCAAACTCATAGTTCTCGATCTTAGCTTCAACAAGATCGCAACAACCAAAGCAATAGGCC
AGCTAGTTGCCAACTACAACTCTCTCGTTGCTCTCAACATCCTTGGAAACCCGATTCAGAGCAATGTAGGCGAAGATGTG
CTGCGCAAGACCGTCTCCAGCTTGCTCCCTAAGCTAGTTTATCTCAACAAGCAGCTCATTAAACCGCAGAGAGCCAGGGA
AGTGCTTAAAGACAGCGTCGCGAAAGCTGCTTTTGGTGGTGGAGATTCTCTGCACCACAGACGCAAAAGAACATCTGCCA
AGAGAGTTGTGGGATCACCTTCCCCTAGCTCCCATCACCAGAAAGGAAAGGGACGTGGTTCCAAAGGCAGAAGCCAGCAC
CAGCTGAAGAAAACTTCATATGCGGAGACACCTTCACATTGA