Details for Chinese cabbage Locus Brara.G03569

Position : A07 ( 5`- 26609036 .. 26610349 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03569

Protein [Map View]
MENERGKLIYLATLAYLAKRYDDMTKSMRKVCEYEIELTDVERELLAIGYKNVMTTKRASLRALSSIEEKEDSKGNKQNV
KLINKKLEIVKHEFFSVCNDILSLIDSHLIPSTTNVESTVYYYAMKANYFRYMAEFGSDAERQGAADNSLEAYKIAMEMA
EGGLSPTNLVRLGLALNFSIFNYVILKSTESACKLAKKAYDEAISELDGADKQSYEDTTFIVDILRDNLSVWTGEVNTDT
PQNKE*

DNA
ATGGAAAACGAGAGAGGGAAGTTGATTTACCTGGCTACGCTTGCTTACCTAGCTAAAAGATATGACGATATGACGAAATC
GATGAGAAAAGTATGCGAGTATGAAATAGAGCTAACTGACGTAGAGAGAGAACTACTAGCAATTGGCTACAAAAATGTGA
TGACGACTAAGAGAGCATCATTGAGAGCATTATCTTCCATTGAAGAAAAGGAAGACTCCAAAGGAAACAAGCAAAACGTG
AAATTGATTAATAAAAAACTAGAGATAGTTAAACATGAGTTTTTCAGTGTTTGTAATGACATTTTGTCTCTCATTGATTC
TCATCTCATTCCATCAACTACCAATGTTGAGTCAACCGTTTATTACTACGCAATGAAAGCAAATTATTTTCGATATATGG
CAGAGTTTGGTTCTGATGCTGAACGTCAAGGAGCTGCAGATAATTCTCTCGAGGCATATAAGATTGCAATGGAAATGGCA
GAGGGGGGTTTATCACCAACGAATTTGGTTAGACTTGGCTTGGCTTTGAACTTCTCGATTTTCAACTATGTGATCCTTAA
ATCTACTGAAAGTGCGTGTAAGTTGGCTAAAAAGGCTTACGACGAAGCAATCTCTGAACTTGACGGTGCTGACAAACAGT
CGTACGAAGATACCACGTTTATAGTAGATATACTTCGAGATAATCTTTCCGTGTGGACAGGAGAGGTGAACACTGATACC
CCGCAAAACAAGGAATAG