Details for Chinese cabbage Locus Brara.G03568

Position : A07 ( 5`- 26603825 .. 26605176 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03568

Protein [Map View]
MTGCFSFSEVIERAYKYGFKRSGLRPVTIDLKDGTVVHFWVSKTRDESKPNLLLIHGLGASAIWQWYDVARRLSPHFNLF
IPDLVFFGGSSTTRPERSDVFQAQTLMRALEAQSVKRFSLVGLSYGGFVGYRMASMYGDAVEKVVICCAAVCVEEKDMRD
GVFSVSDLDEASKILVPESVKKLRELIGYIFYKPALARLVPPCLLHDFIEHFFCGVLVLPTQQEHVINSIHYILSKNSSR
LYTYI*

DNA
ATGACAGGTTGCTTCAGCTTCTCTGAAGTAATAGAACGGGCTTACAAATACGGGTTCAAAAGATCCGGTTTACGACCCGT
AACCATCGACTTGAAAGACGGAACCGTGGTCCATTTCTGGGTATCCAAGACCCGAGACGAATCCAAACCCAACCTCCTCC
TCATCCACGGGCTCGGAGCTTCTGCCATCTGGCAATGGTACGACGTCGCACGACGCCTCTCTCCTCATTTCAACCTCTTC
ATCCCCGACCTCGTTTTCTTCGGCGGATCCTCCACGACCCGACCCGAAAGATCCGACGTTTTCCAGGCCCAGACGCTTAT
GCGGGCCTTAGAGGCCCAGTCCGTGAAACGTTTCAGCCTCGTCGGTCTTAGCTACGGCGGGTTCGTCGGTTACCGAATGG
CGTCGATGTACGGAGACGCCGTGGAGAAGGTGGTGATATGCTGCGCCGCCGTGTGCGTGGAGGAGAAGGACATGAGGGAC
GGCGTTTTCTCCGTGTCGGATCTTGATGAAGCTTCCAAGATTCTCGTGCCGGAGTCTGTGAAGAAGCTACGGGAACTTAT
CGGTTACATCTTCTACAAGCCGGCGTTGGCGAGACTGGTTCCTCCTTGTCTGCTCCATGATTTCATCGAACATTTCTTTT
GCGGAGTACTTGTTCTACCGACACAACAAGAGCATGTTATTAATTCTATCCACTATATTTTGTCAAAAAATTCTAGTAGA
TTATACACATATATTTAA