Details for Chinese cabbage Locus Brara.G03558

Position : A07 ( 5`- 26543591 .. 26544786 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03558

Protein [Map View]
MDAFDAIPNHVVIDILNKVADVKTLIRCRSVSKRFNSLAAQSDSLLLQLDQFLGAAEPEPEVNSPVASFFRSIFKSILPI
FSRSAKPAETPKSPAQILAGFNRIRNLDVELYGGDANLEKGAAVKWKAEFGETLKSSVIVAFRSATVNASATESPVNAVE
TDSEFVCGLKTRVVWTINALMAASTRHHLMGDLVKEHKEMERLTVRDRDEEGTVVMSAAGMKEYREAEARVDEKGLGVER
VRDRTEVPNVRMSMRHAPMLKLKSGICLEAATLVVVRPSGVSSDDNDAELATEAFAADCMYGEAVTALLKRRRNVLEMNS
F*

DNA
ATGGACGCTTTTGATGCGATTCCTAATCATGTGGTCATCGACATTTTGAACAAAGTCGCTGACGTCAAAACGCTGATACG
ATGTCGTTCCGTCTCGAAACGATTCAACTCGCTCGCTGCTCAGTCAGACTCGCTCCTTCTCCAGCTCGATCAGTTCCTCG
GCGCCGCCGAGCCGGAGCCGGAGGTTAATTCTCCGGTGGCTAGCTTCTTCCGTTCGATCTTCAAATCCATCCTCCCGATC
TTCTCCAGATCCGCTAAACCGGCCGAGACTCCTAAATCTCCGGCTCAGATTCTCGCCGGATTTAACCGGATCCGGAACCT
GGACGTGGAGCTATACGGCGGCGACGCTAATCTCGAGAAAGGCGCCGCCGTTAAGTGGAAGGCGGAGTTCGGAGAAACTC
TCAAGAGCTCCGTCATCGTCGCTTTCCGATCAGCGACGGTCAACGCGTCTGCAACGGAATCTCCGGTCAACGCCGTGGAG
ACCGATTCGGAGTTCGTCTGCGGTTTAAAGACGCGCGTGGTGTGGACGATCAACGCGCTGATGGCGGCCTCGACGCGCCA
CCACCTGATGGGAGACTTGGTGAAGGAGCACAAGGAGATGGAGAGACTAACCGTGCGCGACAGAGACGAGGAAGGGACGG
TGGTGATGAGCGCGGCGGGGATGAAAGAGTACAGGGAGGCGGAGGCGCGTGTGGACGAGAAAGGCTTGGGAGTAGAGCGC
GTGAGGGATCGCACGGAGGTGCCTAACGTGAGGATGAGTATGAGACACGCGCCGATGCTGAAGCTGAAGAGCGGGATCTG
TCTCGAGGCCGCGACGCTCGTGGTCGTAAGGCCGAGCGGCGTGAGTTCCGATGATAATGATGCTGAGCTGGCGACGGAGG
CGTTCGCCGCCGATTGTATGTACGGAGAAGCCGTTACGGCGTTGCTTAAGCGTAGGAGAAATGTGTTAGAGATGAATTCC
TTCTAG