Details for Chinese cabbage Locus Brara.G03555

Position : A07 ( 5`- 26508637 .. 26510389 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.G03555

Protein [Map View]
MEAALNMYNSITFQQPDSFGGGELMEALVPYINSVSNSSPYLASAFIQPAASAFPPSLPTFPAYYPEDYSTFMTQPFTYG
SDLHQTGSLTGLNHLSSSQTHPLPPMHHQSHNNTFSNLLSPKPLLMKQTGATGSCFAYGAPAKPTKLYRGVRQRHWGKWV
AEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGEFGEYKPLHSTVDAKLEAICQSMAE
AEKNGKTMTKASKKRASKTVSSPEKVKAENNSNSVGGSPPVTEFVESAGSSPLSDLTFADTEEPPQWNETFSLEKYPSYE
IDWDSILS*

DNA
ATGGAAGCTGCTTTGAATATGTACAATAGCATAACGTTTCAACAGCCAGATTCGTTTGGTGGTGGTGAACTCATGGAAGC
GCTTGTCCCTTATATAAATAGCGTTTCCAATTCTTCTCCTTATCTCGCGTCTGCGTTTATTCAACCCGCAGCGTCTGCGT
TTCCTCCTTCTCTACCTACCTTCCCCGCTTACTACCCGGAAGACTATTCAACGTTCATGACCCAACCGTTTACTTACGGG
TCGGATCTTCACCAAACCGGGTCATTAACCGGGCTCAACCACCTCTCTTCCAGCCAAACTCATCCTCTTCCTCCCATGCA
CCATCAGAGCCACAACAACACCTTCTCGAACCTTCTCAGCCCTAAGCCGTTACTGATGAAGCAGACCGGTGCCACCGGAT
CTTGTTTCGCCTACGGTGCTCCGGCCAAGCCGACGAAGCTGTACAGAGGCGTGAGGCAGCGTCACTGGGGGAAATGGGTG
GCGGAGATCCGTTTGCCGAGGAACCGTACCCGTCTCTGGCTTGGGACGTTCGACACGGCGGAGGAAGCTGCGTTGGCCTA
CGACAAGGCGGCGTATAAGCTGCGTGGCGATTTCGCCCGGCTTAACTTCCCTAACCTGCGTCACAATGGGTCCCACATCG
GAGGCGAGTTCGGCGAGTACAAACCGCTTCACTCCACCGTCGACGCCAAGCTCGAAGCTATATGCCAGAGCATGGCGGAG
GCGGAGAAAAACGGCAAAACGATGACAAAAGCATCGAAGAAACGTGCCTCGAAGACGGTTTCATCGCCGGAGAAAGTCAA
GGCGGAGAATAACTCGAACTCGGTCGGTGGATCTCCGCCGGTGACGGAGTTCGTTGAGTCCGCCGGTTCTTCGCCGTTGT
CGGACTTAACGTTCGCCGACACTGAGGAGCCGCCGCAGTGGAACGAGACGTTCTCGTTGGAGAAGTATCCGTCGTACGAG
ATAGATTGGGATTCGATCCTGTCTTGA